KEGG   Streptomyces bingchenggensis: SBI_07039Help
Entry
SBI_07039         CDS       T01678                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00190  Oxidative phosphorylation
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_07039 (sdhA)
   00650 Butanoate metabolism
    SBI_07039 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SBI_07039 (sdhA)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SBI_07039 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SBI_07039 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA NAD_binding_8 YjeF_N
Motif
Other DBs
NCBI-ProteinID: ADI10159
UniProt: D7C3D4
LinkDB All DBs
Position
complement(8419872..8421818)
Genome map
AA seq 648 aa AA seqDB search
MSTYAEYTTGEPISDAKAPDGPIEERWNRRRFEAKLVNPANRRKHTVIVVGTGLAGGAAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSIRRLFYDTVKGGDFRAR
ESNVHRLAEVSVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALTRQIAAGNVEMHPRTEMLDLIVIDGRARGIVARDLISGEVSTYFADAVVLASGGY
GNVFYLSTNAKNSNATAIWRAHRRGAYFANPCFTQIHPTCIPRSGDHQSKLTLMSESLRN
DGRIWVPKAKGDTRPPAEIPEDERDYYLERIYPSFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIARMGRKAVSEKYGNLFEMYERITAEDPYQVPMRIYPAIHYTMGGLWV
DYDLQTTVPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPSTINDYLARHPHGEVD
PGHPAVTEAVSEVTDRLARLLANDGDRTPDSFHRELGELLWDECGMARTDTGLRKALDRI
PALREEFWRRIKVPGTGEELNQSLEKANRVVDYLELAELMCLDALHRAESCGGHFREESQ
TPDGEAARDDESFSYAGAWEFSGTGSAPVLHREDLVFEYVHPTQRSYA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctatgcggagtacacgaccggcgagccgatcagcgacgccaaggccccggac
ggccccatcgaggagcgctggaaccgccgccgcttcgaggcgaagctggtcaaccccgcc
aaccgccgcaagcacaccgtgatcgtggtcggcaccggcctcgcgggcggcgcggccggg
gcgacgctggccgaacagggctaccacgtggtgcagttctgctaccaggactcgccccgc
cgggcccattcgatcgcggcccagggcggtatcaacgcggccaagaactaccgcaacgac
ggcgactccatccgccggctgttctacgacaccgtcaagggcggcgacttccgcgcccgc
gagtccaatgtgcaccgcctcgccgaggtctcggtggagatcatcgaccagtgcgtggcc
cagggcgtgccgttcgcccgcgagtacggcggtctgctggacacccgctccttcggcggc
gtccaggtctcccgcaccttctacgcccgcggccagaccggccagcagctgctgctcggc
gcgtaccaggcgctgacccggcagatcgccgcgggcaacgtcgagatgcacccccgcacc
gaaatgctcgacctgatcgtcatcgacggccgggcccgtggcatcgtggcccgcgatctg
atcagcggcgaggtctccacgtacttcgcggacgccgtggtcctggcctccggcggctac
ggcaacgtcttctatctgtcgacgaacgccaagaacagcaacgccacggccatctggcgg
gcgcaccggcgcggcgcgtacttcgccaacccctgcttcacccagatccaccccacctgc
atcccgcgctcgggcgaccaccagtccaagctgaccctgatgagcgagtcgctgcgcaac
gacggccgtatctgggtgcccaaggccaagggcgacacccgcccgcccgccgagataccc
gaggacgagcgcgactactacctggagcggatctacccgtcgttcggcaatctggtgccc
cgcgacatcgcctcccgcgccgcgaagaacgtatgcgacgaggggcgcggggtgggcccc
ggcggccagggcgtctatctggacttcgccgacgcgatcgcccggatgggccgcaaggcg
gtgtccgagaagtacggcaacctcttcgagatgtacgagcggatcaccgccgaggacccg
taccaggtgccgatgcgcatctaccccgccatccactacacgatgggcggcctgtgggtc
gactacgacctgcagaccaccgtgcccggcctgttcgcgatcggcgaggccaacttctcc
gaccacggcgccaaccggctcggcgcctccgccctgatgcagggcctggccgacggctac
ttcgtcctcccctccaccatcaacgactacctggcccggcatccgcacggcgaggtcgac
cccggccacccggcggtcaccgaggccgtctccgaggtgacggaccgcctggcgcggctg
ctggcgaacgacggcgaccgcacccccgactccttccaccgcgagctcggcgaactgctg
tgggacgagtgcggcatggcccgcaccgacacggggctgcgcaaggcgctcgaccggatc
ccggcgctccgcgaggagttctggcggcggatcaaggtgccgggcaccggcgaagagctc
aaccagtcgctggagaaggccaaccgcgtcgtcgactacctggagctcgccgagctgatg
tgcctggacgcgctgcaccgcgccgagtcgtgcggcggccacttccgcgaggagagccag
acgcccgacggcgaggcggcccgcgacgacgagtcgttctcgtacgcgggcgcttgggag
ttcagcggcaccggcagcgcgcccgtcctgcaccgcgaagacctggtcttcgagtacgtc
caccccacgcagcggagttacgcatga

DBGET integrated database retrieval system