KEGG   Streptomyces bingchenggensis: SBI_07201Help
Entry
SBI_07201         CDS       T01678                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ADI10321
UniProt: D7C5D3
LinkDB All DBs
Position
8615483..8617084
Genome map
AA seq 533 aa AA seqDB search
MLEHIQRNQECPPERGLYLYDKFIDPPEFFSYQDFPEQVAAYADYFRDQGIEPGTRVLFP
FETSSAVIFAFLGLMELGAVPLSVKPLVLDTPKDSYLDFLGRVARDYEAVRVLETPTVAP
LDLPVPGLPLPPAGIRKPGARLRTPAADELAFVQFSSGSTSFPKGIPVRQDMLRANLDMI
TRTDGRKPEERVSSWLPLYHDMGLVGGLLSCLAAGCDLLLAEPVTFLFDAPGWWEHMARE
GAAGTVIPNFAVDYSLKLMQDLDEEDLAEIDLSRVRSIYLGSEPINLPNLNAFLDLMAPA
GLRRDVFMPCYGMAEAVLLVSSRPVSSEIRVVETPSGVPAISVGPPMPEYTVRLRDEQGR
VCEDGQLGEIELTGGSLAASYLDKLAPLTGDDGYYATGDIGFLDDGELFITGRISDRIKV
GGQSYFASDFEQAIERLEFVRDGRTAVLQIGADIVVLTEVDRAAREDIEGSRAKVVGHLV
RTVGVTVRATDVHYVRPGQLERTSSGKLRRRAIAEAYEQGRLKGLTFDLPAGA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgagcacattcagcgcaaccaggagtgcccgcccgaacggggcctgtacctgtac
gacaagttcatcgacccgcccgagttcttcagctaccaggacttcccggagcaggtcgcc
gcgtacgccgactacttccgcgaccagggcatcgagccggggacgcgggtgctgttcccg
ttcgagacctccagcgcggtgatcttcgccttcctgggtctcatggagctcggcgccgtc
ccgctgtcggtcaaaccgctggtcctggacacgccgaaggactcctatctggacttcctg
ggccgggtcgcgcgggactacgaggcggtccgcgtgctggagaccccgaccgtggccccg
ctcgacctgcccgtccccggcctgccgctgccgccggccgggatccgtaaacccggcgcc
cggctgcgcacccccgcggccgacgagctggcgttcgtacagttctcgtccggctcgacg
tccttccccaagggcatcccggtccggcaggacatgctccgcgccaacctggacatgatc
acccgtacggacggccgtaagcccgaggagcgggtcagcagctggctgccgctctaccac
gacatggggctggtcggcgggctgctgtcctgtctcgccgcggggtgcgatctgctgctc
gccgagccggtgaccttcctgttcgacgcccctggctggtgggagcacatggcccgggag
ggggccgccggcacggtgatccccaacttcgcggtcgactactcgctcaagctgatgcag
gacctcgacgaggaggaccttgccgagatcgatctgtcccgggtgcggtcgatctacctc
ggcagcgaacccatcaacctgcccaacctcaacgccttcctggacctgatggccccggcc
gggctgcggcgcgatgtgttcatgccctgctacggcatggccgaggccgtgctgctggtc
tccagccgccccgtgagcagcgagatccgggtcgtcgagaccccctcgggagtaccggcc
atctcggtgggccccccgatgccggagtacaccgtgcgcctccgtgatgagcaggggcgg
gtgtgcgaggacggccagttgggcgagatcgagctgaccggcggcagcctggccgcctcc
tacctcgacaaactggccccgctgaccggggatgacggctactacgccaccggcgacatc
ggattcctcgacgacggcgagctgttcatcaccggccgcatcagcgaccggatcaaggtg
ggcggccagagttacttcgcctccgacttcgagcaggcgatagagcggctggagttcgta
cgcgacggccgcaccgccgtgctccagatcggtgcggacatcgtcgtcctgaccgaggtg
gaccgcgccgcacgcgaggacatcgagggcagccgggcgaaggtcgtcggccatctggtg
cgcacggtcggggtgacggtgcgggccacggatgtgcactacgtacgccccggccagctg
gagcgcaccagcagcggcaagctgcggcggcgggcgatcgccgaggcgtatgagcagggg
cggctgaaggggctgaccttcgacctgcccgcgggcgcgtag

DBGET integrated database retrieval system