KEGG   Streptomyces bingchenggensis: SBI_07593Help
Entry
SBI_07593         CDS       T01678                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADI10713
UniProt: D7CB30
LinkDB All DBs
Position
9010207..9011673
Genome map
AA seq 488 aa AA seqDB search
MSDLIEHGQLFIGGALAEPAGTDVIEVVSPHTEAVIGRVPHASRADVDRAVAAARTAFEE
GPWARASLEERIAVVTRIKDAVAVRHEEIAKAISSQNGSPYSWSVLGQALGALMVWDSAI
TVARGFVFEERRAGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCSVILKP
SPETPLDSYILAEIVAEAGLPEGVLSILPADREVSEYLVGHPGVDKVSFTGSVAGGKRVM
EVASRNLTRVTLELGGKSAAVILPDADLDAAVAGIVPNAWMNNGQACVAQTRILAPRSHY
DEIADRFAAAASALVVGDPLDPATQVGPLVARRQQQRSLDYIATGQREGAKVLTGGGRPA
AQEKGWYVEPTLFGDVDNGMRIAREEIFGPVICLLPYGDEEEAVRIADDSDYGLSGSVWT
ADVAHGIEIARRIRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGFSSFLEHKMIHLP
QGWDGEQG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcatcgagcacggacagctcttcatcggcggcgcgttggccgaaccggcc
ggcacggatgtgatcgaggtcgtctcgccgcacaccgaggcggtcatcgggcgggtgccg
cacgcctcgcgcgcggatgtggaccgggcggtcgcggcggcgcgcaccgcgttcgaggag
gggccctgggcccgggcgtcgcttgaggagcggatcgcggtcgtcacccgtatcaaggac
gccgtcgccgtccgccacgaggagatcgccaaggccatcagctcgcagaacggctctccg
tactcctggagcgtgctgggccaggcgctgggcgcgctgatggtgtgggactccgcgatc
acggtggcgcgcggcttcgtcttcgaggagcggcgggccggggtcctggggccgctgctg
gtgcggcgcgagccggtcggggtggtcgcggcggtggtgccgtggaacgttccgcagttc
acggcggcggcgaagctggcgcccgcgctgctggccgggtgttcggtgatcctcaagccg
tcacccgagaccccgctggactcctacatcctggcggagatcgtcgccgaggccgggctg
ccggagggggtgctgtcgatcctcccggcggaccgcgaggtcagcgagtacctggtcggg
cacccgggcgtggacaaggtgtccttcaccggctcggtcgcgggcggtaagcgggtcatg
gaggtcgcctcgcgcaatctgacccgggtgacgctggagttgggcgggaagtccgccgcg
gtgatcctgccggacgccgacctggacgcggcggtcgccgggatcgtgcccaacgcgtgg
atgaacaacggccaggcgtgcgtcgcccagacccgtatcctcgccccgcgcagccactac
gacgagatcgccgaccgcttcgccgccgccgcctcggccctggtcgtcggcgacccgctg
gaccccgcgacccaggtcgggccactggtggcgcggcgccagcagcagcggtcgctcgac
tacatcgccaccgggcagcgggagggcgccaaggtgctgacgggcggcgggcgcccggcg
gcccaggagaagggctggtacgtcgagccgacgctgttcggcgacgtcgacaacggcatg
cgcatcgcccgcgaagagatcttcggaccggtgatctgcctgctgccgtacggggacgag
gaggaggcggtgcgtatcgccgacgactccgactacggcctgtccggcagcgtatggacc
gcggacgtggcgcacggcatcgagatcgcgcgccggatccgcaccggtacgtactccgtc
aacaccttcagcctcgacatgctcgggccgttcggcggctacaagaactccggtctgggg
cgggagttcgggcccgagggcttctcctcgttcctggagcacaagatgatccatctgccg
cagggctgggacggggagcagggctga

DBGET integrated database retrieval system