KEGG   Streptomyces bingchenggensis: SBI_08910Help
Entry
SBI_08910         CDS       T01678                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADI12028
UniProt: D7BZY8
LinkDB All DBs
Position
10546782..10547843
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVEPMLAKSAAAIPPGMWYEAKWDGFRALIFRDGDEIELVSRSGKPLTRYFPE
LVGALLANLPPRCVLDGEIVIVRGSRLDFDALLERIHPADSRVRHLAEVTPASFVAFDLL
ALGDESLMDTPLRQRRDVLTEALREAADPVHTAPWTDDPNLAEQWFQQFEGAGLDGVIAK
HPDLGYRPGERVMVKVKHERTADCVVAGMRQHKSGPVVGSLLLGLYDATGRLQHVGVCGA
FSMRRRQELMAELEPLRMDTLDGHPWADWASEGAQTRGRMPGAPSRWTGVKDLSWLPLRP
ERVCEVAYDHMQGDRFRHTARFRRWRPDREPRGCTYAQLEEPVRYDLRAVLGT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgccgccggtggagccgatgctggccaagtccgcggccgccatc
ccgccgggcatgtggtacgaggcgaaatgggacggcttccgggccctgatcttccgcgac
ggggacgagatcgaactggtcagccgctcgggcaaaccgctgacccgctacttcccggaa
ctggtcggcgcgcttctggcgaatctgccgccgcgctgcgtcctcgacggcgagatcgtg
atcgtacgcgggagccgtctggacttcgacgcgctcctggagcgcatccaccccgccgat
tcgcgggtgcgtcatctcgcggaggtgactccggcgagcttcgtggccttcgacctgctc
gcgctgggtgacgagtccctgatggacacgccgctgcggcagcggcgggacgtgctgacc
gaggcgctgcgcgaggccgcggacccggtccacaccgcgccctggaccgatgacccgaac
cttgccgagcagtggttccagcagttcgagggggcgggtctggacggcgtcatcgccaaa
caccccgacctcggctaccggccgggggagcgggtcatggtcaaggtcaaacacgagcgg
accgcggactgcgtggtggcggggatgcggcagcacaagtccggcccggtcgtcggttcg
ctgctgctgggcctgtacgacgccaccggccggctccagcacgtcggcgtgtgcggcgcc
ttctcgatgcgccgccggcaggagctcatggccgaactggagccactgcggatggacacc
ctcgacggacacccctgggccgactgggccagtgaaggggcgcagacgcgtggccggatg
cccggcgcgcccagccgctggaccggcgtcaaggacctgtcgtggctgccgctgcggccg
gagcgggtgtgcgaggtggcgtacgaccatatgcagggcgaccgcttccgccacaccgcc
cggttccgccgctggcggcccgaccgcgagccgcgcggctgcacctacgcccagctggag
gagccggtgcgctacgacctgcgggcggtgctgggcacctga

DBGET integrated database retrieval system