KEGG   Streptomyces bingchenggensis: SBI_09672
Entry
SBI_09672         CDS       T01678                                 
Symbol
cyp47
Name
(GenBank) cytochrome P450
  KO
K17476  pentalenolactone synthase [EC:1.14.19.8]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00998  Biosynthesis of various antibiotics
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Module
sbh_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SBI_09672 (cyp47)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbh00199]
    SBI_09672 (cyp47)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.8  pentalenolactone synthase
     SBI_09672 (cyp47)
Cytochrome P450 [BR:sbh00199]
 Cytochrome P450, bacteria type
  CYP161 family
   SBI_09672 (cyp47)
SSDB
Motif
Pfam: p450 TetR_C_14
Other DBs
NCBI-ProteinID: ADI12790
UniProt: D7C9S8
LinkDB
Position
11545903..11547099
AA seq 398 aa
MKELPRLPFDNPAMLGIAPQMRALQQEEPITRVRTAGEDAWLVTRYDEVRALLADRRLGL
SNPNPEQSAKSAARRFMVALMAGDDYDTEATRHAQMRALLVPRFSTRRMRLMKTRIEHHV
DDLLDQLAAGTPPVDLHRALSFPLPTMVICDLLGVPLADRERFGQWARGTFDQSDNQHSA
NTFQQVVDYITELVARKRTEPGDDLLSELIAHKDSALSDADIAHLGNAVLLFGYETTIVR
IDLGTLLLLRNPAQRALLAENPELAPAAVEEILRLGVGGKGSNAIIPRYAHSDITVGETV
IRTGDAVMLAIGAANYDGRAFPDGDLFDLARNKPKSHLAFGHGARHCIGRTLARIELTAV
FERLFRRLPNLRLAVPEESLRWQEHRITGGFDELPVTF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaaggaactgccgaggttaccgttcgacaacccagccatgctcggcatcgcgccccag
atgcgcgcactgcagcaggaggagccgatcaccagggtgcggaccgccggtgaagatgcc
tggctggtcacccgctacgacgaggtgagggcactactcgccgaccgtcgactcggtctc
agcaatcccaacccggagcagtcggccaagagcgcggccaggcgcttcatggtcgcgctg
atggccggggacgactacgacaccgaggccaccaggcatgcgcagatgcgcgcgctgctt
gtgccccggttctccacgcgccggatgcgcctcatgaagacccggatcgagcaccacgtg
gacgacctgctcgaccagttggccgccggcactccgccggtcgacctgcaccgcgcgctg
tcgtttccgttgccgaccatggtgatctgcgatctgcttggcgtgccgttggccgaccgg
gagcggttcgggcagtgggcgagaggcacattcgaccagagcgacaaccagcactcggcg
aacacctttcagcaggttgtcgactacataacggaactggtggcgcgcaagcgaaccgag
ccgggcgacgacctcctgtccgagctgatcgcccataaagacagcgcactgtccgatgcg
gacattgcccacttgggtaacgccgtgctgttgttcggatacgagaccaccattgtgcgc
atcgacctgggcaccctgctgctgctgcgcaatccggcccagcgcgccctgctggccgag
aatcccgaactcgcaccggccgcggtcgaggagatcctgcgcctgggcgttggcggcaag
ggatcgaacgcgataataccccgctacgcgcacagcgacatcaccgtcggcgagacagtg
atccggaccggagacgcggtgatgctggccatcggcgcggccaactacgacggccgggca
ttccccgacggcgacctgttcgacctggcccgtaacaagcccaagtcgcatctggcattc
gggcacggcgcccggcactgcatcggccgcacgctggcccggatcgagctgaccgcggtg
ttcgagcggctgttccgcagactgcccaacctgcggctcgcggtacccgaggagtcgctg
cgctggcaggagcaccggatcaccggcgggttcgatgaactccccgttaccttctaa

DBGET integrated database retrieval system