KEGG   Streptomyces bingchenggensis: SBI_09673
Entry
SBI_09673         CDS       T01678                                 
Name
(GenBank) hypothetical protein
  KO
K18056  1-deoxypentalenic acid 11beta-hydroxylase [EC:1.14.11.35]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00998  Biosynthesis of various antibiotics
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Module
sbh_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SBI_09673
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.35  1-deoxypentalenic acid 11beta-hydroxylase
     SBI_09673
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-ProteinID: ADI12791
UniProt: D7CBB4
LinkDB
Position
11547347..11548198
AA seq 283 aa
MTDTFSDYVDCTPLLDDREALDRFYDEHGYLCLRGALDRELVRTTAEQMLEGLIALGHTA
PGTTLDTLTIESFEAVDEVAMHDYVKYDDLWNHPSTLKVWEKVFGEPVFVFKSTTIRYYP
SAAGSAEPSFLTPLHQDGFYIGPNKDFRTAWVPLLATTPDIGGVAVADGSHKKGPREHVV
TENFRRFGHAVRGIPAEEFGADEQLLFSPMEPGDVIIFHAFMCHKSIPNVSVDPVGMRMS
MDTRIQPASSHRGFNALTPWAESAKDPSKGVMSKITGTPTTTE
NT seq 852 nt   +upstreamnt  +downstreamnt
atgacggacactttcagcgactacgtcgactgcacgcctcttctcgacgaccgtgaggcc
ctcgaccggttctacgacgagcacggctacctctgtctgcgcggcgctctggaccgtgaa
ctcgtccggaccacggccgagcagatgctcgagggcctgatcgcactcggccacaccgcc
cccggcaccacgctcgacaccctcaccatcgagtccttcgaggcggtcgacgaggtggcg
atgcacgactacgtcaagtacgacgacctgtggaaccacccctcgaccctcaaggtctgg
gagaaggtcttcggcgagcccgtcttcgtcttcaagtcgacgacgatccgctactacccc
tccgctgcgggctccgcggagccgagtttcctgactccgctgcaccaggacggcttctac
atcggcccgaacaaggacttccgcaccgcctgggtgccgctgcttgcgacgacccccgac
ataggcggcgtcgccgtcgccgacggcagccacaagaagggcccgcgcgagcacgtcgtc
accgagaacttccgccgcttcggccacgccgtgcgcggtatcccggcggaggagttcggc
gcggacgagcaactgctgttctcgcccatggaaccgggcgacgtgatcatcttccacgcc
ttcatgtgtcacaagtccatcccgaacgtctcggtggacccggtcggcatgcggatgtcg
atggacacccgcatccagcccgcctcctcgcaccgcgggttcaacgccctgaccccctgg
gcggagtccgcgaaggacccctccaagggagtcatgtcgaagatcaccggcacccccacc
accaccgagtga

DBGET integrated database retrieval system