KEGG   Streptomyces bingchenggensis: SBI_09680
Entry
SBI_09680         CDS       T01678                                 
Symbol
cyp48
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00909  Sesquiterpenoid and triterpenoid biosynthesis
sbh00998  Biosynthesis of various antibiotics
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Module
sbh_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    SBI_09680 (cyp48)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    SBI_09680 (cyp48)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbh00199]
    SBI_09680 (cyp48)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     SBI_09680 (cyp48)
Cytochrome P450 [BR:sbh00199]
 Cytochrome P450, bacteria type
  CYP183 family
   SBI_09680 (cyp48)
SSDB
Motif
Pfam: p450 SRP72
Other DBs
NCBI-ProteinID: ADI12798
UniProt: D7CBC1
LinkDB
Position
11555630..11557024
AA seq 464 aa
MTEQTTFSAGAAPGALPVVGHALQIMRHPVNFMASLSAHGDLVEIKIGPTTAYVPTHPEL
LRHVLTNDRIFDKGGIFYDRARDIAGNGLVTCPFADHRRQRRLMQSAFTRGQLKRYAEAM
HAEIEDTASRWQDGMVVDAFQEMYGLALRTVGRTLYSTPVSPELAAKVERSFDVVLNGLF
RQMFLPASIRRLPLPSQRRYKSNLDFLHETTQQLIDDYRSSDTERDDLLAALIASRDDDG
GKLGDKEIHDQVITVMAAGTETVAATLTWVFYLLSQHPEIEAALYDEIDTVLDSRAPQWD
DLPNLSLADRIISETLRLHPPAWLFTRLTASPTELAGRQLPTGSTVVFSPAAVAQYEDAF
DNPKKFDPDRWLPDRIAPASRHAYVPFGTGARKCIGDLYARTEATLGLATILGRWRVTCE
PGMDIRPVPLATVYHPRRLRLRLDARTPRRKTSAVPVPAGGDVT
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaccgagcagaccaccttctcggcgggagcggcgcccggggcgctccccgtcgtggga
cacgccctccagataatgcgtcaccccgtgaacttcatggcctcgctgtcggcccacggc
gacctggtcgagatcaaaatcggccccaccacggcctacgtcccgacccaccccgaactg
ctgcggcacgtcctgaccaacgaccgtatcttcgacaagggcggcatcttctacgaccgt
gcccgtgacatcgccggcaacggcctcgtcacctgcccgttcgccgaccaccgccgccag
cgccggctgatgcagtcggcgttcacccgcggccagctcaagcggtacgccgaggccatg
cacgccgagatcgaggacacggcgtcgcgctggcaggacggcatggtcgtcgacgctttc
caggagatgtacggcctggccctgcgtacggtcggccgcaccctgtactccacacccgtc
agccccgagctggcggcgaaggtggaacgttccttcgacgtcgtgctcaatggcctgttc
cggcagatgttcctgccggcctcgatccgccggctgcccctgccgtcccagcgccgctac
aagagcaacctggacttcctgcacgagaccacccagcagctcatcgacgactaccgcagc
tccgacaccgagcgcgacgacctgctcgccgccctgatcgcctcccgcgacgacgacggc
ggcaagctcggcgacaaggagatccacgaccaagtcatcaccgtcatggcggccggcacc
gagaccgtcgctgccaccctcacctgggtcttctacctcctctcccagcacccggagatc
gaggccgcgctctacgacgagatcgacaccgtcctcgacagccgcgccccgcagtgggac
gacctgccgaacctctccctggccgaccggatcatctccgagacgctgcgactgcacccg
ccggcctggctgttcacccgcctcaccgcctccccgaccgaactcgcgggccgtcagctg
cccaccggctccaccgtcgtcttcagccccgccgcggtcgcccagtacgaggacgccttc
gacaaccccaagaagttcgaccccgaccgctggctcccggaccgtatcgcgccggcctcc
cgccacgcctacgtgcccttcggcaccggcgcccgcaagtgcatcggcgacctctacgca
cgcaccgaggcgaccctggggctcgccaccatcctcggccgctggcgggtcacctgcgag
cccgggatggacatccgcccggtcccgctggccaccgtctaccacccgcgccggctgcgc
ctgaggctggacgcacgcaccccgcgccggaagacctccgccgtccccgtaccggccggg
ggtgacgtgacgtga

DBGET integrated database retrieval system