KEGG   Sorghum bicolor (sorghum): 110429736Help
Entry
110429736         CDS       T01086                                 

Definition
(RefSeq) alanine aminotransferase 2 isoform X1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00220  Arginine biosynthesis
sbi00250  Alanine, aspartate and glutamate metabolism
sbi00710  Carbon fixation in photosynthetic organisms
sbi01100  Metabolic pathways
sbi01200  Carbon metabolism
sbi01210  2-Oxocarboxylic acid metabolism
sbi01230  Biosynthesis of amino acids
Module
sbi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110429736
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110429736
   00220 Arginine biosynthesis
    110429736
Enzymes [BR:sbi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     110429736
Amino acid related enzymes [BR:sbi01007]
 Aminotransferase (transaminase)
  Class I
   110429736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Pox_A_type_inc
Motif
Other DBs
NCBI-GeneID: 110429736
NCBI-ProteinID: XP_021301861
LinkDB All DBs
Position
1
AA seq 484 aa AA seqDB search
MAPASSVAVENLNPKVLKCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDQILFCNIGNPQS
LGQQPVTFFREVLALCDHPCLLEKEETKSLFSADAISRAKQILATIPGRATGAYSHSQGI
KGLRDAIAAGITSRDGFPANADDIFITDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYS
ASIALHGGALVPYYLDEKTGWGLEISDLKKQLEDARSKGIDVRALVVINPGNPTGQVLAE
DNQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYGEDDLPLVSFQSVS
KGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKVGDESYA
SYKAEKDAILQSLARRAKALEDAFNKLEGISCNKAEGAMYLFPQIHLPQKAIEAAKAAEK
APDAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEDKIPAVITRFKAFHEAFMA
EYRD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgcctccagcgtcgccgtggagaacctcaacccaaaggtcttaaaatgtgag
tatgcagtccgtggggagattgtcatccatgctcagcgcttgcagcaacaactacaaacg
caaccagggtctcttcctttcgatcagatcctcttctgcaacattgggaatcctcaatct
cttggtcagcaacctgtgacattcttcagggaggttcttgctctttgtgatcatccatgc
ctcttggaaaaagaggaaaccaaatcattgttcagtgctgatgctatttctcgagcaaag
cagattcttgcaactattcctggaagggcaaccggtgcatatagtcacagccagggtatc
aaaggactgcgtgatgcaattgctgctggtatcacctcacgtgatggattccctgcaaat
gcagatgacattttcattacagatggagcaagtcctggggtccacatgatgatgcaatta
ctgattaggaatgagaaggatggcattctgtgcccaattcctcagtaccccttgtactcg
gcctccatagctcttcatggtggagctcttgtcccctattaccttgatgaaaaaactggg
tggggtttggagatctctgatcttaagaagcaactcgaagatgctcggtcaaaaggcatt
gatgttagggccttggtggttatcaatccaggaaatccgactgggcaggttcttgctgaa
gacaaccaatatgacatagtgaaattctgcaaaaatgagggccttgttcttctagctgac
gaggtatatcaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatt
gcaagatccatgggatacggcgaggatgatctccctctagtatcatttcagtctgtttcc
aaaggatactatggagagtgtggtaaaagaggaggttacatggagatcactggcttcagt
gctccggtaagagagcagatctacaaggtagcttcagtgaacctgtgctccaatatcact
ggtcaaatccttgcaagcctcgtcatgaatccaccaaaggttggggacgaatcatatgct
tcctacaaggcagagaaagatgcaatccttcagtctttagctcgtcgtgcaaaggcattg
gaggatgcattcaacaagcttgagggaatttcatgtaacaaggctgaaggagcaatgtac
cttttccctcagattcatctgccacagaaggcaattgaggctgctaaagctgctgagaaa
gcacctgatgcgttctatgctctccgtctccttgaatcaactggaattgttgtggtccct
ggatctggatttggtcaagttcctggaacatggcacatcagatgcactatcctgccgcaa
gaagacaaaatccccgcggtgatcacccgcttcaaggctttccatgaggcgttcatggct
gagtaccgcgactaa

DBGET integrated database retrieval system