KEGG   Sorghum bicolor (sorghum): 110430835Help
Entry
110430835         CDS       T01086                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00010  Glycolysis / Gluconeogenesis
sbi00053  Ascorbate and aldarate metabolism
sbi00071  Fatty acid degradation
sbi00280  Valine, leucine and isoleucine degradation
sbi00310  Lysine degradation
sbi00330  Arginine and proline metabolism
sbi00340  Histidine metabolism
sbi00380  Tryptophan metabolism
sbi00410  beta-Alanine metabolism
sbi00561  Glycerolipid metabolism
sbi00620  Pyruvate metabolism
sbi00903  Limonene and pinene degradation
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110430835
   00053 Ascorbate and aldarate metabolism
    110430835
   00620 Pyruvate metabolism
    110430835
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110430835
   00561 Glycerolipid metabolism
    110430835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110430835
   00310 Lysine degradation
    110430835
   00330 Arginine and proline metabolism
    110430835
   00340 Histidine metabolism
    110430835
   00380 Tryptophan metabolism
    110430835
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110430835
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    110430835
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110430835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110430835
NCBI-ProteinID: XP_021304577
LinkDB All DBs
Position
10
AA seq 557 aa AA seqDB search
MASAAAATRRAAASLASRRRLSGSFPLVAAGRRAAVPSALRMPGNGMRGLLPGVLQRFST
AAAVEEPITPSVQVNYTKLLINGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDINRAV
AAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAAHIEVPM
VARLMRYYAGWADKIHGLVVPADGPHHVQILHEPIGVAGQIIPWNFPLLMFAWKVGPALA
CGNTLVLKTAEQTPLSALYISKLLHEAGLPEGVVNVVSGFGPTAGAALASHMDVDKLAFT
GSTDTGKVVLELAARSNLKTVTLELGGKSPFIIMDDADIDHAVELAHFALFFNQGQCCCA
GSRTFVHERVYDEFVEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSG
ANLVTGGDRLGEKGYYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASP
YGLAAGVFTNSLDTANTLTRALRAGTVWINCFDIFDAAIPFGGYKMSGIGREKGIDSLKN
YLQVKAVVTPIKNAAWL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctgccgctgccacacggagggcggccgcctcgctcgcctcacgccgccgc
ctctccgggtccttccccttggtggccgccgggcggcgggcagctgtcccctctgctctc
cgaatgccaggtaatgggatgcgcggactgttgccaggcgtccttcagaggttcagcact
gcagcagcagtagaggagcccatcacgccctcagtccaagtgaactatacaaagctcctc
attaatggcaactttgttgatgctgcatccggcaagaccttcccaactctggaccctcgt
acaggggaggtgattgctcatgtggctgagggtgatgcagaggacattaaccgtgcagta
gctgctgcccgcaaggcttttgatgaagggccatggccgaagatgactgcctatgagagg
tcccgtatcctactgcggtttgctgatttgattgagaagcacaatgatgagcttgctgct
ttggagacgtgggacaacggaaagccatatgagcaagcagcccatattgaagtaccaatg
gtggcccgtcttatgcgttactatgctggttgggctgataagatccatgggctcgttgtg
ccagctgatggcccacaccatgtacagatcttgcatgagccaatcggtgttgcaggtcag
atcatcccatggaacttccctcttctgatgtttgcctggaaagttggccctgctttggca
tgtggaaacactctcgtgctcaagactgctgagcaaactcctctatcggctttgtatatc
tccaagctgttgcatgaggctggactacctgagggtgttgtgaatgtcgtttctggtttt
ggccctactgctggtgctgctcttgctagtcacatggatgttgataagcttgcatttacg
ggatctaccgataccggcaaagttgttcttgagttggctgcaaggagcaaccttaagaca
gtgacactggagttaggaggcaagtctccttttatcatcatggatgatgctgacattgac
catgctgttgagcttgcgcactttgccctgttctttaaccaggggcaatgctgttgtgct
ggatctcgcacatttgtacatgagcgtgtttatgatgagtttgtggagaaagccaaggct
cgtgcattgaagcgcgtcgttggtgatccattcaggaaaggtgttgaacagggcccgcag
attgacgacgagcaattcaacaagatcttgcgctacattaggtctggtgttgacagtgga
gctaaccttgtgacgggtggtgataggttgggtgagaaaggttactacatccagccaacg
attttctcagatgtccaggatggcatgaagattgctcaggaggagatatttgggcctgtt
cagtcaatcctcaagttcaaggatctcaatgaggttattaagagggcaaatgcgagccca
tatggattggccgctggtgtgttcaccaatagcttggacacagccaacaccctgacgcgt
gcgctcagggctgggaccgtctggattaactgcttcgacatcttcgatgctgcaattccc
tttggtgggtacaagatgagcggcattgggagggagaagggcattgacagcctgaagaac
tacctgcaagtgaaggcagtcgtcacccctatcaagaacgccgcgtggttgtag

DBGET integrated database retrieval system