KEGG   Sorghum bicolor (sorghum): 110433383Help
Entry
110433383         CDS       T01086                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein MFP2
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00071  Fatty acid degradation
sbi00592  alpha-Linolenic acid metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
sbi01212  Fatty acid metabolism
Module
sbi_M00087  beta-Oxidation
sbi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110433383
   00592 alpha-Linolenic acid metabolism
    110433383
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110433383
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110433383
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110433383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 110433383
NCBI-ProteinID: XP_021311031
LinkDB All DBs
Position
3
AA seq 723 aa AA seqDB search
MAAKGRTELDVGADGVAVITIHNPPVNSLSIDVLYSLKESYEEAFRRSDVKAIVVTGKGG
KFSGGFDISSFGGLQGGQKMQPKVGYIAIDILTDTVEAATKPSVAAIDGLALGGGLEVAM
ACHARIATPTAQLGLPELQLGIIPGFGGTQRLPRLVGLTKSLEMMLLSKPIKGGEAHQLG
LVDALVSPNDLVNTARQWALDIYECRRPWIKSLYKTDKLEPLGEAREILKFARAQAQKQA
ANLHHPLVCIDVIEEGIVAGPRAGLWKEATSFQELLFSDTCKSLVHVFFSQRATSKIPGA
TDLGLMPRKITKVAILGGGLMGSGIATAMILSNYPVVLKEVNEKFLNAGIDRIKANLQSR
VRKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFADLEKYCPSHCV
LATNTSTIDLNLIGEKTKSQDRIVGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLDVGKK
IKKTPIVVGNCTGFAVNRMFFPYTQSALFFVDLGMDVYKIDRACTKFGMPMGPFRLADLV
GFGVAVATGMQYLENFSERVYKSMLLPLMMEDNRAGEATQKGFYKYEGKRKATPDPEIMK
YIEKSRSMAGVAPDPELLKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIASIFGM
GFPPYRGGVIYWADSIGANYIHGKLEEWTKRYGGFFKPCSYLAERAAKGIPLSAPAKKAQ
ARL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaggggaggacggagctggacgtgggcgctgacggcgtggccgtaatcacc
atccacaatccgcctgtcaactcgctctccatcgacgtcctatatagcttaaaggaaagc
tatgaagaagcatttcggagaagcgatgttaaagcgattgttgttacagggaaaggaggg
aaattttctggaggatttgatattagttcctttggtggtcttcagggaggccaaaaaatg
caaccaaaggttggttacatagcaatagatattctcacagatactgtagaagctgctaca
aagccatcagtggcagcaattgatggtcttgctcttggtgggggtttagaagttgccatg
gcatgccatgcacggattgcaactccaacagctcaattaggtcttccagaacttcaatta
ggaattattccaggatttggaggaacacagcgactcccacgactagttggactgacaaaa
tctttggaaatgatgctgttatctaagccaatcaagggtggtgaggcacaccaactgggt
ctggttgatgccttggtttctcctaatgatttggtgaatactgctcgtcaatgggctttg
gatatatatgaatgtaggaggccctggatcaaaagcctttataagactgacaagctagaa
cctcttggggaggctagggaaattctgaagtttgcaagagctcaagctcaaaagcaggca
gctaatctacatcacccacttgtttgtattgatgtcattgaagaaggtatagttgcagga
ccacgagctggactctggaaggaagcaacttctttccaggaactgcttttctcagatact
tgtaaaagcttagttcatgtgttcttttctcagcgggcaacgtctaagattccaggtgct
acagacttggggttgatgcctaggaaaataactaaagttgccattttaggtggtggactt
atgggttcaggaattgcgactgcaatgatattaagtaactatcctgtggtacttaaagaa
gtaaatgagaaattcctaaatgctggaatcgacagaatcaaagccaatttgcagagtcga
gtaaggaaagggaaaatgaccgaagagagatatgagaaggctatgtctctcgtcacaggt
gtccttgattatgaacgtttcaaagatgtggacctcgttatagaggcagttattgagaat
gtgaagttgaagcagcaaatatttgcggacttggagaagtactgtccttcacattgcgtc
cttgctactaacacatctacaattgatcttaatctgattggggagaaaacaaagtctcaa
gatcgtattgttggtgcacacttctttagtcctgcacatgtaatgccacttctggaaata
gttcgtactcagcacacttcaccacaagttgttgttgacttgctggacgttgggaagaag
attaagaagacaccaatagtggttgggaactgtactggctttgcagttaacaggatgttc
tttccatacactcaatcagcactcttttttgttgatcttggtatggatgtttataagatt
gatcgtgcctgtacaaaatttggaatgcccatgggtcctttcagactggcagatctggtt
ggttttggtgtggctgtagccactggcatgcaatacctggaaaacttctcagagagggtc
tacaaatcaatgctacttcctctgatgatggaggacaatagggcaggtgaagccacccaa
aaaggattttacaagtatgagggcaagaggaaggccactcctgatcctgaaattatgaaa
tatattgaaaaatctaggagcatggcaggagttgcaccagatcctgagttgctgaagcta
agtgagaaagacatagttgagatggtgtttttcccggtgataaatgaagcctgccgagtc
cttgatgagggtattgcagtgaaggcttctgatctagacattgcttcaatcttcggcatg
gggttcccaccttataggggcggtgtcatatactgggcagattccatcggtgcaaattac
atccatggaaagttggaggagtggacaaagcggtatggtggcttcttcaagccttgctct
tacctcgctgagagagctgcgaaagggattcctctgagtgcaccggcaaagaaagctcag
gctcggctataa

DBGET integrated database retrieval system