KEGG   Sorghum bicolor (sorghum): 8054103Help
Entry
8054103           CDS       T01086                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00010  Glycolysis / Gluconeogenesis
sbi00020  Citrate cycle (TCA cycle)
sbi00620  Pyruvate metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
sbi01200  Carbon metabolism
Module
sbi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8054103
   00020 Citrate cycle (TCA cycle)
    8054103
   00620 Pyruvate metabolism
    8054103
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     8054103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 8054103
NCBI-ProteinID: XP_002442933
UniProt: A0A1Z5R4Y7
LinkDB All DBs
Position
8
AA seq 458 aa AA seqDB search
MAGLLNLQSTLLPSASALRRRAGAPGPSSSRRRCRVEAKIREIFMPALSSTMTEGKIVSW
TAAEGDRLAKGDPVVVVESDKADMDVETFHDGFLAAVLVPAGESAPVGSAIALLAESEEE
IPVAQSQAASFSSSSPSPPPPQETAAQEESLPPPPPPTPAPVAVSAPAPPSPAAQGGGRV
VASPYAKKLAKDLGVDLFSVTGSGPGGRIVAKDVESALAAPKKAVPATAARPDVPLGSTV
PFTTMQGAVSKNMVESLAVPTFRVGYTITTDALDQLYKKIKSKGVTMSALLAKATAMALV
QHPVVNSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLQDADKLDIYSLSRKWKELVDKA
RAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASEPTIVGTKDGRIGIK
NQMQVNVTADHRIIYGADLAAFLQTLAKIIEDPKDLTF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctcctcaacctccagtcgacgcttctcccctcggcgtccgcgctgcgccgc
cgcgcgggcgcgccggggccgtcctcgtcccgccgccgatgccgtgtcgaggccaagatc
cgggagatcttcatgccggcgctcagctccaccatgaccgagggcaagatcgtctcctgg
accgccgccgagggcgaccgactcgccaagggcgaccccgtcgtcgtcgtcgagtccgac
aaggccgacatggacgtcgagaccttccacgacggcttcctcgccgccgtcctcgtcccc
gccggcgagtccgcgcccgtcggctccgccatcgcgctcctcgccgagtccgaggaggag
atcccggtcgcccagtcgcaggccgcctccttctcctccagctccccctcgccgccgcct
ccgcaagaaactgctgctcaagaagagtcccttccgccgccgccacctcctaccccagcg
ccggtggcagtctctgctcccgcgccgccttcgccagcagcacaaggcggggggcgcgtt
gttgcttcgccctacgccaagaagctcgccaaggacctcggcgttgatcttttctcggtc
acggggtcaggccccggcgggcgaattgtggccaaggatgtcgagtctgcgcttgctgcg
cccaagaaggccgtaccagcgactgctgcacggccggatgtgccattgggatcgacggta
ccattcacgacaatgcagggtgctgtcagcaagaacatggtggagagccttgccgtcccg
acattcagggtcgggtacaccatcacgactgatgctcttgatcagctctacaaaaaaatt
aagtcaaagggggttacaatgtcagcactattggctaaggcgacggcaatggctctggtt
cagcatcctgtagtcaactccagctgcagggatgggaagagcttcacatacaacagtagt
atcaacattgctgtggcagtggccatagatggtgggttgattacaccggttcttcaagat
gctgataagcttgacatttattcattgtcaaggaaatggaaggagttggttgataaggca
cgagcaaagcagttgcagcctcatgagtacaactctggcacgtttactctttcgaatctt
ggtatgtttggagttgataggtttgatgcaatactgccacctggaactggagcaatcatg
gccgttggggcatcagaaccgaccattgttggtacaaaagatggtagaattgggatcaag
aaccaaatgcaggtaaatgttaccgctgatcatcggattatttatggagctgaccttgct
gcttttctgcaaacacttgccaagataattgaggatcccaaggatcttacattttaa

DBGET integrated database retrieval system