KEGG   Sorghum bicolor (sorghum): 8055699Help
Entry
8055699           CDS       T01086                                 

Definition
(RefSeq) hexokinase-7
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00010  Glycolysis / Gluconeogenesis
sbi00051  Fructose and mannose metabolism
sbi00052  Galactose metabolism
sbi00500  Starch and sucrose metabolism
sbi00520  Amino sugar and nucleotide sugar metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
sbi01200  Carbon metabolism
Module
sbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8055699
   00051 Fructose and mannose metabolism
    8055699
   00052 Galactose metabolism
    8055699
   00500 Starch and sucrose metabolism
    8055699
   00520 Amino sugar and nucleotide sugar metabolism
    8055699
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    8055699
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbi04131]
    8055699
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     8055699
Membrane trafficking [BR:sbi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    8055699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 8055699
NCBI-ProteinID: XP_002440735
UniProt: C5YUA1
LinkDB All DBs
Position
9
AA seq 459 aa AA seqDB search
MVAAAAERVVAELREACAAPAARLNEVAAAMEAEMRAGLREEGGSKIKMIISYVDNLPTG
NEEGVFYALDLGGTNFRVLRVHLAGKDKRVAKRESKEVSIPPHLMSGNASELFGFIASAL
AKYIASEEGHSNVFDDDKQRELGFTFSFPVRQTSIASGTLIKWTKAFSIDDAVGEDVVAE
LQTAMEKQGVDMRVAALINDTVGTLAAGRYNDEDVVIGVILGTGSNAAYVEEASAIPKLE
GELPKSGNMVINTEWGNFDSSCLPITEYDEALDEESLNPGEQIFEKLISGMYLGEIVRRV
LLKIASQSSIFGNVSHTLLKTRFILRTPDISAMHHDDTPDLRIVAQKLADNLKIMDTSLD
TRKMVVEICDIVTSRSARLAAAGIVGILRKIGRAVPGDERRSVVAIDGGLFEHYAEFRKC
LESTLVELLGEEASKSLVVKLTKDGSGLGAALIAAAQSQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcggcggcggagcgggtggtggcggagctccgcgaggcgtgcgcggcgccg
gcggcgcggctgaacgaggtggcggcggccatggaggcggagatgcgcgcggggctgcgc
gaggagggcggcagcaagatcaagatgatcatctcctacgtcgacaatctccccaccggg
aacgaagagggtgtcttctatgccttggatctgggcggaacaaacttccgcgtcctgcgc
gtgcacctggcggggaaagacaagcgtgtcgccaagcgagagtccaaggaggtgtccatc
cctcctcacctcatgtcaggcaacgcttcggagctgttcggttttatcgcttcggcgtta
gccaagtacatcgcgagtgaagaagggcacagcaatgtgtttgatgatgacaagcagaga
gagcttgggttcacattctctttccctgtccgacaaacttcgattgcatcaggcacgctc
atcaagtggaccaaggcattctcgatcgatgacgctgtaggtgaggatgttgtcgctgag
ctgcagacggccatggagaagcaaggcgtcgacatgcgtgtagctgcactgatcaatgat
accgttgggacactggccgcgggtcggtacaatgatgaggatgtagtcattggtgtgata
ttaggtactggctcaaatgccgcgtacgttgaagaggcaagcgccataccgaagttggag
ggcgagttacccaaatcagggaacatggtgataaacacagaatggggtaacttcgactcg
tcctgcctcccaatcacagaatatgatgaagccttagatgaggaaagcttaaacccaggg
gaacagatcttcgagaagttgatttcgggaatgtatcttggcgaaattgtaaggagggtg
ctgcttaaaatcgcatcacagtcttcaatcttcggcaatgtcagccacactttgctcaaa
actcgcttcattctgaggactccggatatctctgcaatgcaccatgacgatacgcctgac
ctgagaatcgtggctcagaaactggccgacaacctcaagatcatggacacatccttggat
acaaggaagatggtcgtcgagatctgtgacatcgtcaccagcaggtctgcccggctggcc
gcggcagggatcgttgggatcctcaggaagatagggagagcagtgcccggcgacgagcgc
cggtccgtcgtcgccatcgacggcggcctgtttgagcactacgccgagttcaggaagtgc
ctggagagcacgctggtggagctgctcggggaggaggcgtcgaagtcgttggtggtgaag
ctcaccaaggacgggtctggcctcggagccgccctgatcgcagctgctcagtcccagtaa

DBGET integrated database retrieval system