KEGG   Sorghum bicolor (sorghum): 8057804Help
Entry
8057804           CDS       T01086                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8057804
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     8057804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 8057804
NCBI-ProteinID: XP_002445671
UniProt: C5YN49
LinkDB All DBs
Position
7
AA seq 206 aa AA seqDB search
MAAQSFLLAATATATTAALFAAPYSSARPFHSAHFVAGPGGAAAARALVVADASKKAVAV
LKGTSEVEGVVTLTQDDDGPTTVNVRITGLTPGLHGFHLHEFGDTTNGCISTGPHFNPNN
LTHGAPEDEVRHAGDLGNIVANAEGVAEATIVDTQIPLSGPNSVVGRAFVVHELEDDLGK
GGHELSLSTGNAGGRLACGVVGLTPL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcagtccttcctcctcgcagccacggccacggccacgaccgccgcgctcttc
gcggctccctattcctccgcacgccctttccactcggcccacttcgtcgccggcccgggg
ggcgccgccgccgccagggcactcgtcgtcgccgacgcgtctaagaaggccgtagccgtc
ctcaagggcacgtccgaggtcgagggcgtcgtcacgctcacgcaggacgacgacggacct
acaactgtgaacgtccgtatcactggacttactcctggacttcatggcttccacctccac
gagtttggtgatactaccaatgggtgcatatcgacaggaccacattttaatccaaacaat
ctgacacacggtgcaccagaagacgaagtccgtcatgcgggtgacctgggaaacattgtt
gccaatgctgagggcgtagctgaggcaaccattgttgatacccagattccattgagtggc
ccaaattcagttgttgggagagcatttgtggttcatgagcttgaagatgatttggggaaa
ggtggccatgagctcagcctctctactggaaatgctggtggaagactggcatgtggtgtt
gttggcctgactccattgtag

DBGET integrated database retrieval system