KEGG   Sorghum bicolor (sorghum): 8058387Help
Entry
8058387           CDS       T01086                                 

Definition
(RefSeq) probable glutathione S-transferase GSTU1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    8058387
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbi02000]
    8058387
Enzymes [BR:sbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     8058387
Transporters [BR:sbi02000]
 Other Transporters
  Pores ion channels [TC:1]
   8058387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C GST_C_3 GST_C_5 GST_N_4
Motif
Other DBs
NCBI-GeneID: 8058387
NCBI-ProteinID: XP_002460955
UniProt: C5XD56
LinkDB All DBs
Position
2
AA seq 228 aa AA seqDB search
MAGEKKQGLQLLDFWVSPFGQRCRIALDEKGLPYEYLEEDLLAGNKSELLLHANPVHKKI
PVLLHDGRPVCESLLIVQYLDEAFPAATPPLLPAAGDPYARAQARFWADYVDKKLYDCGT
RLWKLKGDGHAQARTEMVEILRTLEGALGDGEFFGGEAFGFVDVALVPFTSWFLAYERFG
DLSVEKECPRLAAWAKRCAERPSVAKNLYSSEKVYEFICGLKKRFGIE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggccggggagaagaagcagggcctgcagctgctggacttctgggtgagcccgttcggg
cagcgctgccgcatcgcgctggacgagaagggcttgccctacgagtacctggaggaggac
ctactggccgggaacaagagcgagctcctgctccacgcaaacccggtccacaagaagatc
cccgtgctcctccacgacggccgccccgtctgcgagtccctcctcatcgtgcagtacctc
gacgaggcgttcccggcggcgacgccgccgctgctccccgccgccggcgatccgtacgcg
cgcgcgcaggcccggttctgggcggactacgtggacaagaagctctacgactgcggcacc
cggctgtggaagctcaagggggacggccacgcgcaggcgcgcacggagatggtcgagatc
ctccgcacgctggagggcgcgctcggcgacggcgaattcttcggcggggaggcgttcggg
ttcgtcgacgtcgcgctcgtgccgttcacgtcgtggttcctcgcctacgagcggttcggg
gacctcagcgtggagaaggagtgccccaggctcgccgcgtgggccaagcgatgcgcggaa
cggcctagcgtcgccaagaacctgtactcgtcggagaaggtctacgagttcatctgcggg
ttgaagaagaggttcggcatcgagtag

DBGET integrated database retrieval system