KEGG   Sorghum bicolor (sorghum): 8061607Help
Entry
8061607           CDS       T01086                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00052  Galactose metabolism
sbi00500  Starch and sucrose metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    8061607
   00500 Starch and sucrose metabolism
    8061607
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     8061607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 8061607
NCBI-ProteinID: XP_021305594
LinkDB All DBs
Position
10
AA seq 925 aa AA seqDB search
MAPSTQAYMQRTGHAKPFTTTTTHGPTTTTGSLHSIIWTAAREEEKTHPAIFPECLCAEV
VAAGSGGGYAVRAVTVDKGGARLRAELAAVAAGGGGGGVHAAYGDDVRNLDVYASLETDS
RLHVRITNADHPRWEVPQSVIPREAPRQITLESSTGAASPHSRVLSAATSDLTFTLHASP
FRFTVSRRSSGDVLFDTSAALVFKDRYLELTTALPADVRASSLYGLGEHTKRTFRLQRND
TFTLWNADIPASTVDVNLYGSHPFYLDVRHPASGGGAAHGVLLLNSNGMDVEYGGSYLTY
KVIGGVLDFYFFAGPAPLDVVDQYTQLIGRPAPMPYWSFGFHQCRYGYKNLADLEGVVAG
YAKARIPLEVMWTDIDYMDAFKDFTLDPVNFPAVPMRQFVDRLHRNGQKYVVIIDPGINV
NQTYGTFVRGMQQDVFLKRNGTNYLGKVWPGYVYFPDFLNPRAAEFWAREIALFRRTLLP
VDGLWIDMNEVSNFVDPAPLNALDDPPYRINNSGVRRPINNKTTPASAVHYGGVREYDAH
NLYGFLEARATHGALLADTGRRPFVLSRSTFVGSGRYTAHWTGDNAATWDDLRYSINTML
SFGLFGIPMVGADICGFGGNTTEELCSRWIQLGAFYPFARDHSAIGTIRRELYLWEVVAR
SARKALGLRYRLLPYLYTLMHEAHTTGAPIARPLFFSYPKDAATYDVDRQFLLGRGVLVS
PVLEPGATTVDAYFPAGRWFSLYDYTLAVASATGKRVTLPAPADTVNVHVAGGNILPLQL
PAPTTSRARRTAFHLLVALGEDGAASGELFLDDGESPEMAGSRGKWSLVRFSCAAGHDGV
TVRSHVVRDAYGPTRKLAIGKVIFLGLHSPAAPQREFSVYVNGVKTANSIGGALGYQRNG
AFGAAQVEGLSLAVGKEFELKVVML
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccagtacacaagcctacatgcagaggacaggacatgccaagccgtttaccacc
accaccacccatggcccaacaacaactactggttcattacactccattatttggacggcc
gcgagagaggaggaaaagacgcatccagccatcttcccggaatgtctgtgcgcagaggtc
gtcgccgccggcagcggcggcgggtacgctgtccgcgccgtgacggtggacaaaggaggg
gcgcgcctccgcgccgagctcgcggccgtcgctgccggcggcggtggcggtggcgtgcac
gcggcgtacggcgacgacgtgcggaacctcgacgtgtatgccagtcttgagacagacagc
cggctgcacgtccgcatcaccaacgccgaccacccacgatgggaggtcccccagagcgtc
atcccgcgcgaggcgccgcggcaaatcaccctggagtcgagcacgggcgccgcctcgccg
cacagccgcgtcctctccgcggcgacgtccgacctgaccttcaccctgcacgcctcgccg
ttccgcttcaccgtgtcccggcgctccagcggcgacgtcctcttcgacacctccgcggcg
ctggtgttcaaggacaggtacctggagctgaccacggcgctgccggcggacgtccgggcg
tcgtcgctgtacgggctgggcgagcacaccaagcgcacgttccggctgcagcgcaacgac
accttcacgctctggaacgccgacatcccggccagcaccgtggacgtcaacctctacggc
tcccacccgttctacctcgacgtgcgccaccccgcctccggcggcggcgccgcgcatggc
gtgctcctgctcaacagcaacggcatggacgtcgagtacggcggctcctacctcacctac
aaggtcatcggcggcgtgctcgacttctacttctttgccggacccgcgccgctcgacgtc
gtcgaccagtacacccagctcatcggccgcccggcccccatgccgtactggtctttcggg
ttccaccagtgcaggtacgggtacaagaacctggctgacctggagggcgtggtggccggc
tacgccaaggccaggatcccgctggaggtgatgtggacggacatcgactacatggacgcg
ttcaaggacttcacgctggatccggtgaacttcccggccgtccccatgcggcagttcgtc
gaccgccttcaccggaacggccagaagtacgtcgtcatcatagacccagggatcaacgtg
aaccagacgtacgggacgttcgtccgagggatgcagcaggacgtgttcctgaagcggaac
ggcaccaactacctgggcaaggtgtggccggggtacgtctacttcccggacttcctcaac
ccgcgcgccgccgagttctgggcgcgcgagatcgcgctgttccggcggacgctcctcccc
gtcgacggcctgtggatcgacatgaacgaggtctccaacttcgtcgacccggcgccgctc
aacgcgctggacgacccgccgtaccgcatcaacaactccggcgtgcgccgccccatcaac
aacaagaccacgccggcgtccgcggtgcactacggcggcgtgcgcgagtacgacgcgcac
aacctctacggcttcctggaggcgcgcgccacgcacggcgcgctgctcgccgacaccggc
cgccgccccttcgtcctcagccggtccacgttcgtggggtccggccggtacaccgcgcac
tggaccggcgacaacgccgccacctgggacgacctccggtactccatcaacaccatgctc
agcttcggcctcttcggcatccccatggtcggcgctgacatctgcggcttcggcggcaac
accaccgaggagctctgcagccgctggatccagcttggcgcgttctacccgttcgcgagg
gaccattcggcgatcggcacgatccggcgggagctgtacctgtgggaggtggtggcgcgg
tcggcgaggaaggcgctgggcctgcggtaccggctgctgccgtacctgtacacgctgatg
cacgaggcgcacacgacgggggcccccatcgcgcggccgctcttcttctcctaccccaag
gacgcggcgacgtacgacgtggaccggcagttcctgctgggccgcggcgtgctcgtgtcg
ccggtgctggagccgggggccaccaccgtcgacgcctacttcccggcggggcggtggttc
agcctgtacgactacacgctcgcggtcgcctcggcgacgggcaagcgcgtcacgctcccg
gcgcccgcggacacggtcaacgtgcacgtggccggcggcaacatcctgccgctgcagctg
ccggcgccgacgacgtcgcgggcgcggcggaccgcgttccacctcctggtcgcgctcggc
gaggacggagccgcgtccggggagctgttcctggacgacggcgagtcgccggagatggcc
ggttcgcgcggcaagtggagcctggtgcggttcagctgcgcggcggggcacgacggggtt
accgtgaggtcgcacgtggtgcgcgacgcctacgggccgacccggaagctggccatcggc
aaggtgatcttcctgggactgcactcgccggcggcgccacagagggagttctccgtgtat
gtcaacggcgtgaagacggccaactcgatcggcggcgcgttagggtaccagaggaacgga
gcattcggcgcagctcaagtggaggggctgtcgctggccgtcggcaaggagttcgagctc
aaggtcgtcatgttgtag

DBGET integrated database retrieval system