KEGG   Sorghum bicolor (sorghum): 8063364Help
Entry
8063364           CDS       T01086                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00250  Alanine, aspartate and glutamate metabolism
sbi00410  beta-Alanine metabolism
sbi00430  Taurine and hypotaurine metabolism
sbi00650  Butanoate metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Module
sbi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    8063364
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    8063364
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8063364
   00430 Taurine and hypotaurine metabolism
    8063364
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     8063364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 8063364
NCBI-ProteinID: XP_002466557
UniProt: C5WMY2
LinkDB All DBs
Position
1
AA seq 493 aa AA seqDB search
MVLSHGVGGSDESVHSTFASRYVRASLPRFRMPEQSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIQASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPQKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTKKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENAMVLKQGLEK
TGKFNIVSKDNGVPLVAFSLKDSSRHNEFEISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDIEKVLHELDALPARVPSGDLAALAAAEASEKAMEKQREVISLWK
RAVLAKKKTNGVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtcacacggtgtcggcggctccgatgagtccgtccactcgacgttcgcgtcc
cgctacgtccgcgcctccctgcccaggttccggatgccggagcagtcgatccccaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacgggaacccgcggctgaacctg
gcctccttcgtcaccacgtggatggagcccgagtgcgacaagctcatccaggcctccgtc
aataagaactacgtcgacatggacgagtaccccgtcaccaccgagctgcagaaccggtgc
gtgaacatgatcgcgcatctcttcaacgctcctctcggggactctgaaactgctgttgga
gtgggcaccgtcggctcgtccgaggccatcatgctggctgggctggcgttcaagaggcgt
tggcagaacaagatgaaggccgccggcaagccctgcgacaagccaaacattgtcaccggc
gccaatgtccaagtttgctgggagaagttcgcgcgctacttcgaggtggagctgaaggaa
gtgaagctgagcgacggctactacgtcatggacccgcagaaggccgtggacatggtggac
gagaacaccatctgtgtcgcggccatcctcggctccacactgaacggcgagttcgaggac
gttaagctgctcaacgacctgcttaccaagaagaacgcggagacaggctgggacacaccg
atccacgtggacgcggcgagcggtgggttcatcgcgccgttcctgtacccggaactggag
tgggacttccgtctgccgctcgtgaagagcatcaacgtcagtgggcacaagtatggcctg
gtctacgccggcatcgggtggtgcatctggaggagcaaggaggacctgccggaggagctc
atcttccacatcaactacctcggcgccgaccagcccaccttcaccctcaacttctccaaa
ggctccagccaggtcattgcacagtactaccagctgatccgccttggctttgagggttac
aagaacatcatggagaattgccaggagaacgcgatggttctgaagcaaggtctggagaag
acgggcaagttcaacatcgtgtccaaggacaatggcgtgccgctggtggccttctccctc
aaggacagcagccggcacaacgaattcgagatctccgacttcctgcgccgcttcggctgg
atcgtgccggcctacaccatgccccccgacgcgcagcacgtgacggtgctccgcgtcgtc
atccgcgaggacttcagccgcaccctcgcggagcgcctggtgctcgacatcgagaaggtg
ctgcacgagctggacgcgctgcccgcccgcgtccccagcggcgacctcgccgcgctcgcc
gccgccgaggccagcgagaaggcgatggagaagcagcgggaggtgatctcgctctggaag
agggccgtcctcgccaagaagaagaccaacggcgtctgctaa

DBGET integrated database retrieval system