KEGG   Sorghum bicolor (sorghum): 8067120Help
Entry
8067120           CDS       T01086                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03030  DNA replication
sbi03410  Base excision repair
sbi03420  Nucleotide excision repair
sbi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    8067120
   03410 Base excision repair
    8067120
   03420 Nucleotide excision repair
    8067120
   03430 Mismatch repair
    8067120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbi03032]
    8067120
   03400 DNA repair and recombination proteins [BR:sbi03400]
    8067120
Enzymes [BR:sbi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     8067120
    6.5.1.6  DNA ligase (ATP or NAD+)
     8067120
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     8067120
DNA replication proteins [BR:sbi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    8067120
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     8067120
DNA repair and recombination proteins [BR:sbi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     8067120
   NER (nucleotide excision repair)
    Other NER factors
     8067120
   MMR (mismatch excision repair)
    Other MMR factors
     8067120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase eIF-3c_N DNA_ligase_OB_2 Presenilin Bud13
Motif
Other DBs
NCBI-GeneID: 8067120
NCBI-ProteinID: XP_021306888
LinkDB All DBs
Position
1
AA seq 931 aa AA seqDB search
MFLLRATSSSTTTATSSLLLRCRPLPSPKTLALAPPPTILPFCFRSRLSASASSASRRRR
ATAAAAAGKSGEKKPPTARAKQADAGPAAAAAAGMSASGGGSSGKRTVADVLMGNARAAA
SKAKKAAPSPKKPRAKADGAEAELEAAAVAEKPPSPVRSKRASSPAKSPKLLADGSTSPA
KSKGPAAAAQLDAAKENSPSPKRSKTLAAKSDTQPSGEGVVSHTDGKKGSPAPTKAKGQA
SQQEEKKRATSPKKAKTTDSDSAKTEEKNTTRATSPKKAKTTDSRKAEEKNTTLELKKKG
SEFDPMAAAYWKPGEPVPFLFLARALDLISNESGRIVITEILSNVFRTVMATTPDDLLAT
VYLSANRIAPPHEGIELGIGDASVIRALAEAYGRKEEHVKKDLKELGDLGLVAKASRSSQ
KMMFKPKPLTIARVLSTFRAIAKESGKDSQDKKRNHMKGLLVAATDCEPQYITRLLQSKM
RIGLAEKTVQMALGQAAVYSDKNSSPPKVQSPFEEAAKIIKQAYSVLPIYDKIVPAILEV
GVWKLPETCKFSIGVPVGPMLAKATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCMEDGS
VEIYSRNAERNTGKYPDVVDAVSRFRKPTVKSFVLDCEIVAYDREKQKILPFQILSTRAR
KGVTINDIKVSVCTFGFDILYINGKPLLQEQLKIRREHLYNSFEEVPGVFQLATAITSND
LEEIQKFLDTAVNSSCEGLIIKTLDKDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIA
AFYGRGKRTGVFGSFLLACYDEQNEEYQTICNIGTGFSEQQLEERSASLRSKVIEKPKAY
YRFADTMDPDVWFEPSEVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLRLRDDKS
PEQATTSDQVADMYRSQKINHGYNQEDEDDD
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcctcagagccaccagcagcagcaccaccacggccacctcctcgctcctcctc
cgatgccgtccgctcccctcgcctaaaaccctagcactcgccccgcctcctactatcctc
cccttctgcttccgctcccgcctctccgcctccgcatcctccgcctctcgccgccgccgt
gcgaccgcggcagccgctgcaggcaaatccggggagaagaagccgccgaccgcgagggcc
aagcaggccgacgcagggcctgcagcggcggcggcggccggaatgtcggcctccggtggc
ggatcctcggggaagcgcacggtggcggacgtgctgatggggaacgcacgggccgctgcc
agcaaggcgaagaaggcagcgccgtcgccgaagaagccccgggcgaaggctgacggcgcg
gaggccgaactggaggctgcggcggtagcggagaaaccgccttcgccggtgaggtccaag
cgggcgtcgtccccagcgaagtcccccaaattgctggctgatgggtctacatcgccggct
aagtccaagggtccagccgcggccgctcaattggatgcggcgaaggagaattccccgtcg
ccaaagaggtccaaaaccctagccgctaaatccgacacccagccttctggtgaaggtgtt
gtctcgcacaccgatgggaagaaggggtcacccgcgcccaccaaggctaaaggccaggct
tcgcaacaagaggagaagaagcgggccacttcacccaagaaggctaaaaccacagattcc
gattcggcaaagacagaggagaagaacaccacccgggccacttcacccaagaaggctaaa
accacagattcccgaaaggcagaggagaagaacaccaccctagagctaaagaagaaaggc
agtgagtttgacccgatggctgctgcctattggaagcctggtgagcccgtgccattcctg
tttctggctcgggcacttgatctcatctccaacgagagtggccgcattgttattacagaa
atcctatcaaacgtgtttcgcacagtgatggcaacaacaccggatgatctcctcgcaact
gtgtacctctcagccaaccggattgcgccacctcatgaggggattgagcttgggattggg
gatgcatcagtcatccgtgcacttgcagaggcatatggacgcaaagaggagcacgttaag
aaggaccttaaggaattgggtgatttggggcttgtggcaaaagcaagcaggtcatcgcag
aagatgatgtttaagccaaaaccactgacaatagctcgggtgcttagcacttttcgggca
attgcaaaggaatcgggcaaagacagtcaagataaaaaaagaaaccatatgaagggactt
cttgttgctgctactgactgtgaaccccagtacatcacacgccttcttcagtcaaagatg
aggattgggctggcagagaaaactgtccaaatggctcttgggcaagctgctgtatattct
gataaaaattcttcgccaccaaaagttcaatcacctttcgaagaggctgcaaaaataatt
aaacaagcatattcagttcttccaatatatgataaaattgtcccagcgatacttgaagta
ggagtttggaagcttccagagacatgcaaattttccataggtgtccctgttggccctatg
ttagcaaaagcaacaaaatctgtctcagagatcattgacaagtttcagggtcttgaatac
acttgtgagtacaagtatgatggtgaaagggctcagatacattgcatggaggatggttca
gtagagatttatagtcggaatgctgaaagaaacactggaaagtatccagatgttgttgat
gcagtttctagatttaggaagcctacagtcaaatcatttgtcttggactgtgaaattgtt
gcctatgatcgtgaaaaacagaaaattttgccttttcagatacttagcacaagggctcgc
aagggtgttaccataaatgacatcaaagtttcagtctgtacttttggctttgatattctt
tacataaacgggaaacctcttctccaggaacaactcaaaattcgtcgagagcatctttac
aactccttcgaagaagtgccaggtgtttttcaattggctactgcaattacatcaaatgac
ctggaggagatacagaaatttcttgacacagctgtcaactccagttgtgaagggttgatt
atcaagacattggataaagacgctacatatgagccagcgaagcgatcaaacaattggttg
aaactgaagaaggattacatggatagcattggtgactctttggacttagtacctattgct
gccttctatggtagaggaaaacgaacaggtgtctttggatcattcctcctggcatgctat
gatgagcagaatgaagagtatcaaacaatatgcaacataggtactggattttctgagcaa
cagcttgaagaacgttctgcgagccttcgaagtaaagtgatagaaaaaccaaaggcatac
tatagatttgctgacacaatggaccctgatgtgtggtttgagccatcagaggtgtgggag
gtcaaagctgcagatctgagcataagccctgtacatcgtgctgctaatggtatagtcgat
cccaataagggtatctccctaagattccctcgtctgttgagattacgtgacgataaaagc
ccagaacaagccaccacgtctgaccaagtcgctgacatgtaccggtctcaaaagatcaac
catggttataaccaggaggatgaggacgatgactga

DBGET integrated database retrieval system