KEGG   Sorghum bicolor (sorghum): 8067426Help
Entry
8067426           CDS       T01086                                 

Definition
(RefSeq) serine/threonine-protein kinase tricorner
  KO
K08790  serine/threonine kinase 38 [EC:2.7.11.1]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbi01001]
    8067426
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8067426
Protein kinases [BR:sbi01001]
 Serine/threonine kinases: AGC group
  NDR family
   8067426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Seadorna_VP7 COQ7 Kinase-like CRA Pox_ser-thr_kin DUF4168
Motif
Other DBs
NCBI-GeneID: 8067426
NCBI-ProteinID: XP_021306967
LinkDB All DBs
Position
1
AA seq 550 aa AA seqDB search
MDSARSWFTKLQTREKSIGKKKELPPNGKESGDDAPSSATKQRVAAAKQYIEKHYKEQMK
QVQDRKERRCSLEKKLADADVSEEEVHNILKQFEKKETEYMRLQRHKMSVEDFDLLTMIG
KGAFGEVRVCREKTTGNVYAMKKLKKSEMLRRGQVEHVRAERNLLAEVDHHCIVKLYCSF
QDSEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIEAIHRHNYIHRDIKPD
NLLLDKYGHLRLSDFGLCKPLDYSNFPDLNEKDVTPTKSSSVHGDGKQQSMPKRSQQEQL
EHWQKNRRTLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYSDEPM
TTCRKIVNWRTHLKFPEEARLTADAKDLISKLLCNVDQRLGTKGAEEIKGHPWFSGLEWD
KLYEIEAAYLPQVTDELDTQNFEKFEESSDSVQCSAKTGPWRKMLSSKDLNFVGYTYKNF
ELVNDHDVPGMAELKKKEKAKRPSVKYLFDSPQGEGEEAHQPEDETASAEGSARKPAEPE
LTRSLSSPST
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggattcagcgaggagctggttcaccaagctccaaacgcgggagaaatccattggaaag
aagaaggaattgcctcccaatggcaaggaatccggcgatgatgcgccatcgagtgcaacc
aagcagagggttgcggcggccaagcagtacattgagaaacactacaaggagcaaatgaag
caagtgcaggacaggaaagaaagacggtgtagtctagaaaagaaattagcagacgctgat
gtgtccgaagaggaggttcacaacatcctgaagcagtttgagaagaaagagacggagtac
atgcgcttgcaaaggcataaaatgagcgtcgaggattttgacttgctaacgatgataggc
aagggagcatttggtgaggtcagagtctgcagagagaagaccacaggaaatgtctatgcg
atgaagaagcttaaaaagtctgaaatgcttcgtcgaggtcaggttgagcatgttagagct
gaaaggaatcttcttgcagaagtggatcaccactgcattgtcaaactatattgctcattc
caggacagtgagtacctgtacctgatcatggaatacctcccaggaggcgacatgatgacg
cttctcatgaggaaagacacattgactgaagatgaggccaggttctacgttggtgagacg
gttcttgcgattgaagcgatccacaggcacaactacatccacagagatatcaagcctgat
aacctgctactggataagtatggtcacttgagattgtcagattttggattgtgtaagccg
ttagactattccaacttcccagacctgaacgaaaaggacgttacgcctacgaaatcatcg
tcggtgcatggggatgggaagcagcagtcgatgccaaagcgctcacagcaagaacagttg
gagcactggcagaagaatagaagaactttggcttactcaactgttggaacaccagactac
atcgctccagaagttcttctgaagaagggctatgggatggaatgtgattggtggtccctt
ggtgcgattatgtacgaaatgctagtgggttatcctccattttattcagatgagcctatg
acaacctgtagaaagatagtaaattggagaacacatttgaaatttcctgaagaagcgagg
ctaacagcagatgcgaaagatctcataagtaaactactttgtaatgtcgaccaacgcctc
gggacaaaaggcgcagaagaaataaaggggcacccctggttcagtggattagaatgggat
aagctatatgaaatagaagctgcgtatctgcctcaagtcacagacgagttggacactcag
aactttgagaaatttgaagagtcctcagatagtgttcagtgttcagcaaagacgggccct
tggagaaagatgctttcttcaaaggatctgaattttgtgggttacacctacaagaacttt
gaacttgtgaacgatcacgatgtccccggcatggctgagctgaagaagaaggagaaggca
aagcgaccaagcgtcaaatatctcttcgattcacctcaaggagagggagaggaggcgcat
cagcctgaagacgaaacagcctccgccgaaggaagcgcccggaaaccagcagagcctgaa
ctgaccagaagcctcagctcgccatccacatga

DBGET integrated database retrieval system