KEGG   Sorghum bicolor (sorghum): 8067785Help
Entry
8067785           CDS       T01086                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00564  Glycerophospholipid metabolism
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8067785
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     8067785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA Pyr_redox NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 8067785
NCBI-ProteinID: XP_002447542
LinkDB All DBs
Position
6
AA seq 628 aa AA seqDB search
MATWRLRRAGAALAASSALAAALAASSASASDPSAAALDAARQRVARPGAAPPPRDAQRA
ALAGSTPAEPLDVLVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGGV
RYLEKAVFNLDYGQLKLVFHALKERKQVIENAPHLCHALPCMTPCFNWFEVVYYWFGLKF
YDLVAGKRLLHLSRYYSVDESVELFPTLAKNGHDRSLRGTVVYYDGQMNDSRLNVGLACT
AAVVGAAVLNYAEVVSLIKDESGERIIGARIRDTLSGKEFETFAKVVVNAAGPFCDSVRK
MANSNVAPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSST
AITMLPEPHEDEIQFILDAISDYLNVQVRRSDVLSAWSGIRPLATDPSAKNTESISRDHV
VFEDYPGLITITGGKWTTYRSMAEDAVNAAVRSGNLKPANGCVTDNLHIVGGYGWDPAAF
TVLAQNYKRMKKTYGGKVIPGAMDSAVSKHLSHAYGTLAEQVATIAQNEGLGKRLAHGYP
FLEAEVAYCARYEYCESAVDFVARRCRLAFLDTDAAGRALPRIVEILASEHKWDKARRKV
ELQKGREFLETFKSSKNAQFRDGKHNGP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtggcgcctccgccgcgccggcgccgccctagctgcctcctccgcgctcgcc
gccgctctcgccgcctcatccgcgtccgcctccgacccctccgccgccgccctcgacgcg
gcccggcagcgcgttgcgcggccgggggcggccccgcccccgcgagacgcgcagcgtgcg
gcgctggcggggtccacccccgctgagcccctggacgtgctcgtcgttggcggtggcgcc
accggatgcggcgtcgcgctcgatgccgccacccgcgggctccgggtaggcctcgtggag
cgcgaggatttctcttctggaacctcctcccgatccaccaaacttatacatggcggcgtc
cgctacttggagaaggcagtgttcaatcttgattacgggcagctgaaacttgtttttcat
gcccttaaggaacgcaagcaggttattgagaatgctccccatttgtgccatgctttgcca
tgcatgactccttgctttaactggtttgaggttgtatactactggtttggtttgaagttt
tatgatcttgttgctggaaaaaggctactacatttgtcacgatattattctgtagatgaa
tcagttgagcttttcccaacccttgcaaaaaatggccatgatcgtagcctaagaggaaca
gttgtgtactatgatggtcaaatgaatgactctcggctaaatgtggggttggcatgcact
gctgcagttgttggtgcagctgttctcaattatgctgaagtggtctccctcattaaggat
gaatcgggagagagaatcattggtgcacgcattcgtgacacactatcaggtaaggagttt
gaaaccttcgcaaaggtggttgttaatgcagcaggaccattctgtgactctgtgaggaag
atggctaacagtaacgtagcacctatgatctgtcctagtagtggagtgcacattgtactt
cctgattactactcccccgaagggatggggctaattgtccctaaaaccaaggatggcaga
gttgtatttatgttgccatggttaggaaggaccgtggcgggaacaactgattctagcaca
gcaataacaatgcttcctgaaccgcatgaggatgaaatacagttcatattggatgcaatc
tctgactatcttaatgttcaggtaaggcgttcagatgttctttctgcctggagtggtata
cgtcctttggccacagatccgtctgcaaagaacactgagagtatttctcgagatcatgtt
gtatttgaagactacccagggctaataacaattactggtggaaaatggacaacctatagg
agtatggctgaagatgctgtaaatgcagcagtcaggtctgggaatttgaaaccagctaat
ggttgtgtgactgataatttgcatattgttggtggatatggatgggatcctgctgctttt
acagttcttgctcagaattataagcgaatgaaaaagacatatggtggcaaggttattcca
ggtgcaatggacagtgctgtatcgaagcatttgtcacatgcatatggaactttggctgaa
caagtggctactattgcccagaacgaaggcttgggaaagcgccttgctcatggctaccca
tttttggaagctgaagtagcatactgtgctcgttatgagtactgtgaatctgctgtggac
tttgttgcaaggaggtgccggctcgctttccttgacacagatgctgctggtagagcattg
ccccgaatcgttgaaattttagcttcagagcacaagtgggacaaggcaaggaggaaggtg
gagctgcagaagggtagagagttcttggaaacattcaagtcatctaagaatgcccaattc
cgtgatgggaaacataatggaccatga

DBGET integrated database retrieval system