KEGG   Sorghum bicolor (sorghum): 8068030Help
Entry
8068030           CDS       T01086                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03030  DNA replication
sbi03410  Base excision repair
sbi03420  Nucleotide excision repair
sbi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    8068030
   03410 Base excision repair
    8068030
   03420 Nucleotide excision repair
    8068030
   03430 Mismatch repair
    8068030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbi03032]
    8068030
   03400 DNA repair and recombination proteins [BR:sbi03400]
    8068030
Enzymes [BR:sbi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     8068030
    6.5.1.6  DNA ligase (ATP or NAD+)
     8068030
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     8068030
DNA replication proteins [BR:sbi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    8068030
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     8068030
DNA repair and recombination proteins [BR:sbi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     8068030
   NER (nucleotide excision repair)
    Other NER factors
     8068030
   MMR (mismatch excision repair)
    Other MMR factors
     8068030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 Lactamase_B_2 RMMBL NAR
Motif
Other DBs
NCBI-GeneID: 8068030
NCBI-ProteinID: XP_021312483
LinkDB All DBs
Position
3
AA seq 1405 aa AA seqDB search
MASLLSSPEDSKSLSVTTSSLFLSTIASLPSPHAFSIPTSASTPLPPVPASVPPTALIPG
SRFLVDAFRHAGDFSVAYFLSHFHSDHYSGLGPSWRRGLVFCSAPTARLVSSVLSVPPQL
VVSLDVGVRITVDGWSVTAVDANHCPGAVQFLFASPGPSAERYVHTGDFRYTESMTRDPN
LLEFVRADAVFLDTTYCNPKFTFPSQEDSVDYVVNAIKRVKEESSVSGERVLCLITTYAV
GKERILLEVARRCGCSIHVDSRKMKILTVLGFGGENGVFTEDATGTDVHVIGWNILGETW
PYFQPNFVKMKEIMIERGYAKAVGFVPTGWMYETKKEGFAVRVKDSLEIHLVPYSEHSSY
NELRDYIKFLHPKKVIPTVGVDAGRLDSKEAVALQKHFAGLVDETANKQEFLMAFHRRLI
DATHSCKDVVAKCSSQHDGEDAALLPAITSASEQQDTLTLRENITQEMIKELSDFLPSWV
SQEQITDLLMSSGGDVVKAASEFFERERDFFEEANVSCNDTPKSEKKHSSDCASSADVSS
QQESPLFSQKPVEYSAKLVNLSPMIMKLNTPKKVKKRGSSTTNKPKKKGRLTSSTESGGR
KQSTITNYFIRATETTEAAFKRGRTEKVTEEAHQNNVENGDQLAYTAKTQDQSVDQLLQI
VDGSMSREYAVSLLEKANGDVAVAVDIFYSSSESNNVIDVDKNIVLQNAQSETVDKCSKT
DMASDFSQATPKMTNLHGTSLAHGDSANTSLPIEKYLPIEHACWTAGQPAPYLHLARTFD
LVEKEKGKIKTTAIFCNMFRSLLALSPDDVLPAVYLCTNKISPDHENMELNIGGSLVVTT
LEESLGTSRSKIHEMYKTYGDLGTVAQECRQNQTLLAPPRPLSIRDVYSTLRKLSAISGS
GSAGRRKILVLHLIRSCRETEMKFLVRTLVRNLRIGAMMKTILPALAHAVVFDRNCAADP
VVSLEGIKSQLQVCMNSLSTEVAEAYNVIPNLDLLIPSLLREGTAFSASSLAMVPGTPIP
PMLARITNGLTQSLKAFHGRSFTCEYKYDGQRAQIHKLPDGSVRIFSRQMKESTSRFPDL
VNMIKELCKPEVSSFILDAEVVGIDRKKGNKLMSFQELSSRERGNKHSSISIENIKVDIC
VFVFDIMFHGGERLLDCPLRQRRKYIHDLFQEKPGYFELAQQLTVEACEASPDNSSTLAR
MNTFFKNACQSSCEGIMLKTLDVDAGYSASKRCDSWLKVKRDYVEGLGDSLDLVPIGAWY
GNGRKAGWYSPFLMACYNPETEEFQSVCRVMSGFSDDFYKEMKEFYSGERILPKKPVYYK
TDEQPELWFTAEQIWEIRGADLTLSPVHHAAIGLVHPSRGISVRMPRYIRSVPDRSPEDC
GTATDIASMFKAQTRKMDVSSEGQE
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctcctctcctcccccgaagattccaaatcgctgtccgtcaccacatcatcg
cttttcctttccaccatcgcctcgctcccctctccccacgccttctccatccccacctcc
gcctccacgcctctcccgcccgtcccggcctctgtgcctcccaccgcgctcatcccgggc
tcccgcttcctcgtcgatgccttccgccatgctggggacttctctgtcgcctactttctc
tcgcacttccactccgaccactacagtggcctcggcccttcctggcgccgcggccttgtc
ttctgctccgcgccaaccgcacgcctcgtctcatccgtgctctctgtcccgccgcagctt
gtcgtctccctcgatgtcggtgtccgtatcaccgttgatgggtggagcgtcaccgcggtg
gacgccaatcactgccccggtgccgtccagttcctattcgcctcccctgggccgagcgcc
gagaggtatgtacacaccggtgacttccgttacacagagtctatgacgcgcgatcctaac
ctgctggagttcgtccgtgctgatgcggtgtttctggacaccacatactgtaaccccaag
tttacattcccttcgcaagaggattctgtggattacgtagtgaatgcaatcaaacgtgtg
aaagaggagagttcagtatcaggagagcgtgtgctgtgtctgatcacgacctatgcggtc
ggcaaagagaggattttgctggaggttgcacggcgctgcgggtgttcaatccatgtggac
agtaggaagatgaaaattttgacagtgttggggttcggtggggagaatggcgtttttact
gaggatgcaacagggacggatgtgcatgttattgggtggaatatcttaggggagacttgg
ccctacttccagccgaattttgtgaagatgaaggagatcatgattgagagagggtatgcg
aaggctgtcgggtttgtaccaactgggtggatgtatgaaaccaagaaggaaggttttgct
gttagggtgaaagattcactcgaaatccatcttgttccttacagtgagcactcaagctac
aatgagttgcgtgactatattaagtttttgcacccaaagaaggtgatccctactgttgga
gtggatgctgggaggctcgatagtaaggaggcagttgctctgcagaagcattttgctggg
ttggtggatgagacagcaaacaaacaggagttcttgatggcattccatcgtaggttgata
gatgctactcatagctgcaaagatgtggttgctaagtgctcgagccagcatgacggggag
gatgctgctttgttaccagcaatcacttctgcttctgaacaacaggatactctgactctg
agggagaatattacgcaggaaatgattaaagaactatcagatttcctaccatcgtgggtc
agccaggaacagatcacagacctgctgatgagttcaggtggtgatgttgttaaagcagca
tctgaattttttgagcgggaaagagatttctttgaagaagcaaatgtttcttgtaatgac
acacccaagtcagagaaaaagcattcttctgattgtgcgtcttctgctgatgtaagtagt
cagcaagaatctcctttattttcgcagaagccagtggaatactctgcaaaactggtaaat
ttgtctcctatgataatgaaactaaatactcccaaaaaggtaaaaaagaggggttccagc
actacaaacaagccaaaaaagaaaggacgattaacttcctcgacagaatctggtgggcgc
aagcagtccacaattacaaattatttcattagagctacagaaaccacagaagctgctttt
aaaaggggtaggactgaaaaagtaactgaggaggcacatcaaaataatgtggaaaatggt
gatcagttagcttatactgcaaaaacacaagatcagagtgtagaccagcttctccagatt
gtagatggtagcatgtctagagaatatgcagtttctttgcttgagaaggcaaatggagat
gtggctgtagcagttgacatattttacagttcaagtgagagtaacaatgtaattgacgtt
gataagaacattgtgctgcagaatgcacaaagtgaaactgtagataaatgtagtaaaaca
gacatggctagtgatttttctcaggctactccaaagatgacaaacttacatggaacttct
ttagcacatggagattctgccaatacatcactgccaattgaaaagtatctacctattgaa
catgcttgctggacagcaggacagcctgcaccatacttgcatttggctcgcacatttgat
ttggttgaaaaggaaaaaggaaagatcaaaactaccgcaatattttgcaacatgttcagg
agtttgcttgctttatcccctgatgatgttctacctgctgtttatctgtgtactaataaa
atttctcctgaccatgaaaatatggaactgaacattggtgggagtctagttgtaactact
ctggaggaatcattaggaaccagcagatctaaaatacatgaaatgtacaaaacttatggt
gatcttggtacggttgcccaagaatgtcgtcagaaccaaacactgcttgctcctccccgt
cctctctcgattcgtgatgtatattccacacttcggaaactaagtgcaatatcaggtagt
ggaagtgctgggaggagaaaaattcttgtcttgcatcttattcggtcttgtagagaaaca
gaaatgaaatttcttgtcagaacactggttcgtaacttgcgtattggggctatgatgaag
acgatattacctgcgcttgcacatgctgttgtttttgatagaaactgtgcagcagatcct
gttgtgtccttggaaggcataaaatcacaactacaggtttgtatgaacagtctttcaact
gaagttgccgaggcatacaatgtcattcctaatctagatctgctcattccttctcttttg
agagaaggcactgcattttcagcttcatccttggcaatggtgcctggcacacctattcca
cctatgcttgctagaattactaatgggttgactcagtcgctgaaagctttccatggcaga
tcatttacttgtgagtacaagtatgatggtcagcgagcccagattcacaaactacctgat
ggatctgtgcgaatattttcaaggcaaatgaaagaatcaacttccagatttcctgatctt
gtgaacatgattaaggagctgtgcaagcctgaagtgtccagctttatactggatgctgag
gtggtgggaattgacaggaagaaaggaaacaagttgatgtcgttccaagagctatcttca
agagaaagagggaacaagcattcctcaatttcaatagagaacataaaggttgacatttgt
gtgtttgtttttgacatcatgttccacggtggagagaggctactggattgccctcttcgg
caaagaagaaagtacattcatgacttgttccaggaaaagccaggatattttgagttagct
cagcaactaactgtagaagcctgtgaagcttcaccagacaattctagcactttggctagg
atgaacacatttttcaaaaatgcatgccagtcttcttgtgagggtataatgttaaagact
ttggatgtcgatgctggatactctgcttccaaacgctgtgattcatggttaaaggtcaag
cgtgactatgtggaaggcttaggtgatagccttgacttagttccaattggtgcatggtat
ggaaatggacgtaaagctgggtggtacagcccttttctcatggcatgctacaaccctgaa
actgaagagttccaaagtgtatgccgtgttatgtctggtttctcagatgatttttataaa
gagatgaaggagttttattccggggaaaggatactgcccaagaagcctgtttactacaaa
acagatgagcaaccagagctgtggttcaccgcagaacaaatttgggagatccgaggtgca
gacctgacgttgtcccctgttcaccatgcggccattgggcttgtccatccatcgcgcggc
atctcggtgaggatgcccaggtacatccgttcagttccagaccggagcccagaggattgc
ggcactgccaccgatattgctagcatgttcaaagctcagacccggaagatggatgtcagc
agcgagggccaggagtag

DBGET integrated database retrieval system