KEGG   Sorghum bicolor (sorghum): 8069680Help
Entry
8069680           CDS       T01086                                 

Definition
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03440  Homologous recombination
sbi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    8069680
   03450 Non-homologous end-joining
    8069680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbi03032]
    8069680
   03400 DNA repair and recombination proteins [BR:sbi03400]
    8069680
DNA replication proteins [BR:sbi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     8069680
DNA repair and recombination proteins [BR:sbi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     8069680
    BRCA1-C complex
     8069680
   NHEJ (non-homologous end-joining)
    MRX complex
     8069680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 8069680
NCBI-ProteinID: XP_021321224
LinkDB All DBs
Position
7
AA seq 757 aa AA seqDB search
MAGSPRPAPATGPATTTDGSARITTHSLLSSPPVQQQQPPPLMSSSPLLPSVSQLLLLLS
YPPFRLPASPPSLPAALPLFLAAAAASVQLCKGGLHDEDAPFKHAACSVEQPARQEKALQ
QPGDDQGTRPGSINRIGRRLIVLDDLDGPPAGGNTLRILVATDCHLGYLEKDEVRRFDSF
ATFEEICSLAVKNKVDFLLLCGNLFHENKPSNSTLVKAIEILLRYCMNDCPVQFQVISDQ
AASLQNRFGQVNYEDPNYKIGLPVFTIHGNQDDPTGLDNLSVNDILTAGNLLNYFGKTDL
GCTSVGKVKIYPLFIRKGETYIALYGLGNIKDGRLKRMLHEPDAVNWMQPEIQDETLGPD
WFNILVLHQKRTRGSPRDAISELLLPRFVDLVIWGHEHECLIDPQEVPGMGFHITQPGFS
IATSLINAEANPKHVLLLEIKGREYRSTKIPLQSVRPFEYAEVVLEDQVDVDPGDEATIC
EHLHKVVNNLIEKSREGAPTGSKPMLPLVRIKVNYTGYSMINSKQFGQHYVGKVANPQDI
LLLTRSRQRHQTMQESCNISEELCTNDLNQETVEALIADSNLKLEILSVDDLNSAINDFV
KEDDKTAFHACLQQNIEEAINKLTTAKEDSVDQEKLQEKESQSKERTSSQNLQTDTLSVF
EKQKCLTTTEEKEQQALDSDDDEPIESSDPEESGSQQAGKKRRAAPGGGGSTAASWRRKT
DLASFQRVPAKEDDANAAKKRRAPIAAGRYGAVIRRN
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggctggatctccccggccggcgccggcgacggggccggcgacgacgacggacggcagc
gccaggatcacaacacattcactcctctcctctcctcccgtccagcagcagcagccacct
ccattgatgtcctcctctcctctcctcccttctgtctctcagctgctcctcctcctctcc
tatcctcccttccgtctcccagcttctcctccctcccttccagctgccctccctctcttc
cttgcggctgctgctgcaagcgtgcagctgtgcaagggaggactgcacgacgaagatgct
cccttcaagcatgcagcgtgcagcgtagagcagccagcgagacaagaaaaggctctgcag
cagccaggggacgaccaggggactcgtccagggtcaattaatcgtattggacgacgacta
atcgtcctggacgacctggacggtcccccagcggggggcaacactctacgcatacttgtg
gcgacggattgccaccttggctaccttgagaaggacgaggtgcgcagatttgactccttc
gccacatttgaagagatctgctctttggccgtaaaaaataaggtggatttcctactcctt
tgtggcaatttgtttcatgagaacaaaccttccaattcgacattggtgaaggccattgag
atcctgctgcgctattgcatgaacgactgcccagttcagtttcaggtgatcagtgatcaa
gcagccagcctccagaacaggtttggtcaagtgaattatgaagacccaaactacaaaatt
ggcttgcctgtgtttaccatccatgggaaccaagatgatcctactggacttgataacctg
tcagtaaacgatatattgacagcaggaaatcttttgaattattttggcaagacagatctt
ggatgcaccagtgttggcaaagtaaaaatttatccactatttatcagaaagggtgaaact
tatattgccctatatggacttggcaatattaaggatgggagactcaagagaatgttacat
gaacctgatgcggttaactggatgcaacctgaaatccaagatgagacactgggccctgac
tggttcaacatcttggtccttcaccaaaagaggacacgtggaagtcctagagatgccata
agtgagctcctcttgccacgttttgtggacttggtaatttggggccatgagcatgaatgt
ctgattgatccccaggaggttcctggaatgggtttccatatcacccaaccaggcttctca
attgctacctcactgatcaatgctgaagcaaatccaaagcatgtgctcttgttggaaatc
aaggggagagagtacaggtcaaccaaaatacctctgcagtctgttagaccttttgagtat
gcagaggttgtactggaggaccaggttgatgttgatcctggtgatgaagcaaccatttgt
gagcatttgcacaaagttgtgaacaaccttattgagaagagcagggaaggagcacccact
ggatcaaagcctatgcttccattagttagaataaaggtcaattacactgggtattcgatg
ataaattcaaagcaatttggtcaacactatgtgggcaaggttgcaaacccacaagacatc
cttcttcttacaagatcaaggcaaaggcatcaaactatgcaagaaagctgtaacatttct
gaagagctttgtacaaatgatctcaaccaggagacagttgaagcgcttattgcagacagt
aacttgaaactggagatcctttccgtagacgatttgaacagtgcaatcaatgattttgtc
aaggaggacgacaagacggcatttcacgcttgcctgcagcaaaacatcgaggaagcgata
aacaaattgactactgccaaagaggattctgttgaccaagaaaaactccaggaaaaggaa
agccaatccaaggaaagaacaagctcccaaaatctgcagactgacacactcagcgtgttt
gagaagcagaagtgcttgacgacaacagaggagaaggagcagcaggcccttgactcggat
gatgatgaacccatcgaatcttcagacccggaggagagtggtagccagcaagcaggaaag
aagaggcgagcggcaccgggcggcggaggatctacagctgccagttggaggaggaagacg
gacctggcttcgttccagagggttccggcgaaggaagacgacgccaacgcggccaagaaa
cgacgggctcctattgccgccgggaggtatggggctgtgatcaggaggaattga

DBGET integrated database retrieval system