KEGG   Sorghum bicolor (sorghum): 8070647Help
Entry
8070647           CDS       T01086                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00630  Glyoxylate and dicarboxylate metabolism
sbi00710  Carbon fixation in photosynthetic organisms
sbi01100  Metabolic pathways
sbi01200  Carbon metabolism
Module
sbi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sbi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sbi_M00532  Photorespiration
sbi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    8070647
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8070647
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     8070647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 8070647
NCBI-ProteinID: XP_002450304
UniProt: C5Y519
LinkDB All DBs
Position
5
AA seq 169 aa AA seqDB search
MAPTVMASSATAVAPFQGLKSTATLPVARRSTTSLAKVSNGGRIRCMQVWPAYGNKKFET
LSYLPPLTEEQLLKQVDYLLRNNWVPCLEFSKEGFVYRENSTSPCYYDGRYWTMWKLPMF
GCTDASQVYKELQEAIASYPDAYVRILGFDNIKQTQCVSFIAYKPAGSE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaccgtgatggcctcgtccgccaccgccgtcgctccgttccagggtctcaag
tccaccgccaccctccccgtcgcccgccgctccaccaccagcctcgccaaagtcagcaac
ggcggcaggatccggtgcatgcaggtgtggccggcgtacgggaacaagaagttcgagacg
ctgtcgtacctgccgccgctgacggaggagcagctgctgaagcaggtggactacctgctg
cgcaacaactgggtgccctgcctcgagttcagcaaggaaggcttcgtgtaccgcgagaac
tccacctccccgtgctactacgacggccgctactggaccatgtggaagctgcccatgttc
ggctgcaccgacgcgtcgcaggtctacaaggagctgcaggaggccatcgcctcctacccg
gacgcctacgtccggatcctcggcttcgacaacatcaagcagacgcagtgcgtcagcttc
atcgcctacaagcccgcgggcagcgagtga

DBGET integrated database retrieval system