KEGG   Sorghum bicolor (sorghum): 8070885Help
Entry
8070885           CDS       T01086                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    8070885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbi03036]
    8070885
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     8070885
Chromosome and associated proteins [BR:sbi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     8070885
   Polycomb group proteins
    PRC2-EZH2 complex
     8070885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 8070885
NCBI-ProteinID: XP_002437898
UniProt: C5Z4W5
LinkDB All DBs
Position
10
AA seq 933 aa AA seqDB search
MEAAAAAPPAVASSASASASAGRSRPSTSAAQDTTITAVQAGEENAASPYVLSVIDSLKK
RITADRLTYIKNRIGENKINLSSYTQRTYNLSKNRQINTSKGTDLASNLLTKRQDDALCT
LHSYDITPVDKDGGNFQDENPFSSSNVIFGGNLGPKNAIRPIKLPEVPKLPPYTTWIFLD
RNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDEAIEDEEEKKEFKHSEDRIIRMTIQE
CGMSDAVLQTLARYMERATDDIKARYEILHGEKTKDSCKKGTEHNAKVEDLYRDKDLDAA
LDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQTAWSGVDDGVPCGIHCYKLASEPDSVA
GVDHMLIDVEEPARSSDNVMNQPGPNKKKNGSSGRKAKSQQSESSSTARVISESSDSEVH
PISNKSPQHSPSPSKVKIGPKGGIRKITNRRIAKRILMSVKKGQREMASSDSNSVSGSSL
ARDMKLRSDTRNGNKELIVSSQQNSPSTRSSKRKSTPQIGNNSVSAEVYNDSTEEANNRH
SATDGYDSSRKEEFVDENICKQEGYLRSWNAIEQGLLVKGLEIFGRNSCLIARNLLGGMK
TCRDVFQYMNYIENSSASGALSGVDSLVKGYIKGTELRTRSRYFRRRGKVRRLKYTWKSA
GYHFIRKRITERKDQPCRQYNPCGCQSACGKQCPCLTNGTCCEKYCGCPKICKNRFRGCH
CAKSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQ
RVLLGRSDVSGWGAFLKNSVTKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE
YVLDAYRMGDKLKFANHAPDPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDR
APAWARKPEASGAKDDGQPSNGRAKKLAQNTRG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcggcggcggcgccgccggcagtggcgtcgtccgcatctgcatcggcttcc
gcgggccggtcgcgcccatctaccagcgctgcccaggacaccactattacggctgtgcaa
gctggagaagaaaatgctgcctccccctatgttttatctgttattgactcgttaaaaaag
aggattacagcagatcgtttgacttacattaagaataggataggggagaataagattaat
ctcagcagctatacacagaggacttacaatttatcaaaaaataggcaaattaatacatca
aagggtactgatttggcatcaaatttgctcacaaaaaggcaagatgatgcgctatgcacc
ctgcatagttatgatattactccggttgacaaagatggtggcaattttcaagatgaaaat
cctttctcctcatcaaatgttatttttggtggaaatcttggtcccaagaatgctattaga
ccaattaaattaccagaagtgccaaagctcccaccttatacaacatggatatttttggac
aggaaccagaggatgacagaagaccaatctgtacttggtcgacggaggatttactacgat
accagttgtggtgaagctctaatttgcagtgacagtgaagatgaagccattgaggatgag
gaggaaaaaaaggaatttaaacattctgaagatcgcattattcggatgacaattcaagaa
tgtggcatgtctgatgctgtactgcaaacactagctcgatacatggagcgggctactgat
gacataaaggccaggtatgaaatcctgcatggtgagaaaactaaggattcttgcaagaaa
ggaactgagcataatgccaaagtggaagatttgtaccgtgacaaagatttggatgcagca
ttggattcctttgacaatctgttttgtcgacgatgtctagtgtttgattgcaagctacac
ggctgttctcaagatttagtatttcctacagaaaaacagacagcttggagtggtgttgat
gatggtgtaccctgtggtattcattgctataaactggcctctgaaccagattctgtagct
ggagttgatcacatgcttattgatgttgaggagcccgctcgctcatcagacaatgtgatg
aaccagccaggcccaaataagaaaaagaacggctccagtggaaggaaggctaaatctcaa
caaagtgaaagctcttcaactgcaagggttatctcagaaagcagtgactcagaagtacat
ccaataagcaataaatctccacaacactcccctagtccctcaaaagttaaaattgggccg
aaaggtggaatcagaaagattaccaatagacgaatcgccaagagaattcttatgagtgtg
aagaaaggacaaagggaaatggcatcatctgattctaattctgttagtggatcctctttg
gcaagggacatgaagcttagatctgatacacgaaatggaaataaggaattaattgtatcc
tcacaacagaattctccaagcacaagaagttccaaaaggaagagtacacctcaaattggg
aataactcggtttctgctgaagtttataatgattcaacagaggaagcaaataaccgtcat
tcagcaactgatggttatgatagttcaaggaaagaagaatttgtcgatgagaatatatgc
aagcaggagggttacttgagatcctggaatgcaattgagcagggacttctggtgaaagga
ttagagatttttggaaggaacagttgtttaattgctcggaaccttcttggtggaatgaag
acgtgcagagatgtttttcagtatatgaattatattgaaaacagcagtgcatctggagct
cttagtggtgttgattctcttgttaaaggatatattaagggtactgagttgcgcacaagg
tcaaggtattttagaaggcgaggtaaagtccgtcgtttgaagtacacctggaaatctgca
ggttaccatttcataaggaagaggattactgaaaggaaggatcagccttgtcgacaatat
aatccatgtggttgtcaatctgcatgtggaaagcagtgtccatgtcttacaaatgggaca
tgctgtgagaaatactgcgggtgtccaaaaatttgcaagaaccgttttcgaggatgtcac
tgtgcaaagagccagtgtcgcagccgccaatgtccatgttttgctgctgacagggaatgt
gatccggatgtttgcagaaactgctgggttgggtgtggtgatggtacattaggagttcca
aaccagagaggagataattatgaatgccggaacatgaaactgcttcttaaacaacagcaa
agggtcttacttggaagatcagatgtctctggctggggagcattcctcaagaatagtgtt
accaaacatgaatatcttggtgagtacactggggaactaatctcacacaaagaagctgat
aagcgtggaaagatatatgatcgtgagaactcatcattccttttcaacctgaacaatgag
tatgttcttgatgcatacagaatgggtgacaagctgaaatttgccaaccatgcccctgac
ccgaattgctatgccaaggttatcatggtagctggtgatcatagagtgggcatattcgcc
aaagaaagaatcctcgctggcgaagagttattctatgattaccgctatgagcccgacaga
gctcctgcttgggcccggaagcctgaggcttcgggagcaaaggatgatgggcaaccgtcc
aatgggcgtgcaaagaagctcgcccaaaacacaagaggctga

DBGET integrated database retrieval system