KEGG   Sorghum bicolor (sorghum): 8078313Help
Entry
8078313           CDS       T01086                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00620  Pyruvate metabolism
sbi00710  Carbon fixation in photosynthetic organisms
sbi01100  Metabolic pathways
sbi01200  Carbon metabolism
Module
sbi_M00168  CAM (Crassulacean acid metabolism), dark
sbi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
sbi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sbi_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    8078313
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8078313
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     8078313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 8078313
NCBI-ProteinID: XP_002451855
UniProt: C5XYZ9
LinkDB All DBs
Position
4
AA seq 960 aa AA seqDB search
MPERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELS
AEYENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQVAQRRRIKLKRG
DFADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQK
HGRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH
ETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL
LARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKRAAKHYIEFWKQVPPNEP
YRVILGDVRDKLYYTRERSRHLLSSGISEIPEEATFTNVEQFLEPLELCYRSLCACGDKP
IADGSLLDFLRQVSTFGLALVKLDIRQESDRHTDVLDSITTHLGIGSYAEWSEEKRQDWL
LSELRGKRPLFGSDLPQTEETADVLGTFHVLAELPADCFGAYIISMATAPSDVLAVELLQ
RECHVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYMNRINGKQEVMIGYSDSGKDAGR
LSAAWQMYKAQEELIKVAKHYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRV
TVQGEVIEHSFGEELLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAVVATKEYRS
IVFQEPRFVEYFRSATPETEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPV
WLGFGAAIKHIMQKDIRNIHVLKEMYNEWPFFRVTLDLLEMVFAKGDPGIAAVYDKLLVA
EDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYITTLNVCQAYTLK
RIRDPSFQVSPQPPLSKEFTDESQPVELVQLNQQSEYAPGLEDTLILTMKGIAAGMQNTG
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcggcaccagtcgatcgacgcgcagctgcggctgctggcccccgggaaggtc
tccgaggacgacaagctcgtcgagtacgacgccctcctcgtcgaccgcttccttgacatc
ctccaggacctgcacggcccccacctgcgcgaattcgtccaggagtgctacgagctctcg
gcggagtacgagaacgaccgggatgaggctcggctcggcgagctcgggagcaagctcacc
agcctgccgccgggggactccatcgtcgtcgccagttccttctcgcacatgctcaacctc
gccaacctcgccgaggaagtgcaggtcgcgcagcgccgccggatcaagctcaagcgtggg
gacttcgccgacgaggcctccgcgccgacggagtcggacatcgaggagacgctcaagcgc
ctcgtctcgcagctcggcaagtcgcgggaggaggtcttcgacgcgctcaagaaccagacc
gtcgacctcgtcttcaccgcccaccccacgcagtccgtcaggaggtctcttctccagaag
cacggcaggatccgtaactgcctgaggcagctctatgccaaggacatcactgctgacgac
aaacaggagcttgacgaggcacttcagagggagattcaagctgctttcagaactgatgaa
atccgcagaacccctcccactcctcaagatgaaatgcgtgctggaatgagttacttccat
gaaactatatggaagggtgtaccaaaattcttgcgccgtattgacactgctctgaaaaat
attgggatcaatgaacgtctcccttacaatgctcctctcattcagttctcttcctggatg
ggtggtgatcgtgatggaaatcctagagtaacaccagaggttacacgggatgtatgcttg
ttggcaagaatgatggctgctaacctgtacttctctcagatcgaagatctaatgtttgag
ctctctatgtggcgctgcagtgatgaacttcggatccgtgcagatgaactacatcgctct
tcaaaaagagctgcaaagcactatatagaattctggaagcaagttcctccaaatgaacca
tatcgtgtcatacttggtgatgtcagggataaattgtactacacacgtgaacgttctcgt
cacctattgtcatctggaatttctgagattccagaggaggcaacttttactaatgttgaa
cagtttctggaacctcttgagctctgctatagatcattatgtgcttgtggtgacaaacct
atagctgacggaagtcttcttgatttcttgcgtcaagtatcaacttttgggcttgccctt
gtgaagcttgacatcaggcaggaatctgatcgacacaccgatgttcttgattcaataacg
acacatcttggaattggctcctatgctgaatggtccgaggagaaacgccaggattggctg
ttgtctgaactgaggggcaaacgtccattgtttggttctgatcttcctcagactgaagag
actgctgatgttctaggcacgtttcatgtccttgcagagcttccagcagattgctttggc
gcgtatatcatctcaatggcaactgccccatctgatgttctcgcggtcgagcttttgcag
cgggagtgccatgtaaagcagccactgagagttgttccactctttgagaaactagcagat
cttgaagcagctccagcggctgtagcacgactcttttcaattgactggtacatgaatagg
attaatggcaagcaggaggtcatgattggatattcagactctggcaaagatgccggccgt
ctctctgcagcatggcaaatgtataaagcacaagaagagctcatcaaggtggcaaagcat
tatggagtgaagttgacaatgtttcatggaagaggtggaacagttggcagaggaggtggt
ccaactcatctggccatattatctcagccaccagacacgatacatgggtcgcttcgtgta
acagttcaaggcgaagttattgagcactcctttggagaggagctcttgtgctttagaact
ttgcaacgctacactgcagctactcttgaacatggcatgcatcctccaatttcccccaag
ccagaatggcgtgctctgatggatgaaatggctgttgtagcaactaaagaatatcgatca
attgtcttccaagaaccacgcttcgttgaatacttcagatcggctacgcctgagactgaa
tatggtaggatgaatattggcagccgtccgtcaaagaggaagcctagcgggggaatagaa
tcgctccgtgcaattccatggatctttgcttggacacaaacaaggttccatctgcctgtt
tggcttggatttggtgcagcgatcaagcacatcatgcagaaggacatcaggaacatccat
gtactgaaagaaatgtacaatgagtggccattcttcagggtcacccttgatttgcttgag
atggttttcgccaagggagacccgggaattgcagctgtatatgacaaattgctagtggct
gaggatttgcaatccttcggtgagcaactaaggaagaactatgaggagacaaaagagctc
ctccttcaggttgctggtcacaaggacgtccttgaaggcgatccttacctgaagcagcgt
ctgcggctgcgtgagtcctacatcaccactctgaacgtgtgccaggcctacaccctgaag
cggatacgtgacccgagcttccaggtgagcccgcagccgcccctgtccaaggagttcacc
gacgagagccagccggtggagctggtgcagctgaaccagcagagcgagtacgcgccaggc
ctggaggacacactgatcctgaccatgaagggcatcgctgccggcatgcagaataccggc
tag

DBGET integrated database retrieval system