KEGG   Sorghum bicolor (sorghum): 8083945Help
Entry
8083945           CDS       T01086                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00020  Citrate cycle (TCA cycle)
sbi00190  Oxidative phosphorylation
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
sbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    8083945
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    8083945
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     8083945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 8083945
NCBI-ProteinID: XP_002463806
UniProt: C5WZ45
LinkDB All DBs
Position
1
AA seq 620 aa AA seqDB search
MWRGCVSRGLRKVKAAASASRLFSTSSSYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFN
TACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDSIQYMCREA
PKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYG
QAMKHNTQFFVEYFALDLLMDNEGICQGVIALNMEDGTLHRFRAANTILATGGYGRAYFS
ATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGER
FMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISE
TAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLHIKGDDPDAVVPGLMAAGEAACA
SVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLGKGVGENTIAWLDKLRNANG
SLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCELISKAWESFHDVKISDRSLIWNSDLIE
TIELENLLINACITMYSAEARKESRGAHAREDFSTRDDESWMKHTLGYWENEKVRLAYRP
VHMNTLDDEVQSFPPKARVY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcggctgcgtgtcgcggggcctccggaaggtcaaggccgccgcctcggcctcc
aggctcttctctacgagctcgtcctacacggtggtggatcacacctatgatgctgttgtc
gtgggagccggaggtgcggggctcagggcagcgattggcctctcggagcatgggttcaac
actgcctgcatcaccaagctcttccccacacgatcacatacagtggctgctcagggaggc
ataaatgctgctcttggcaacatgagtgaagatgactggagatggcatatgtatgataca
gtcaaaggaagtgactggttgggcgaccaagattctattcagtatatgtgcagagaggca
ccaaaagctgttatagaacttgagaactatggcttaccattttccagaaccgaagatgga
aaaatttatcaacgcgcctttggtggacaaagcttagattttggaaaaggtgggcaagcc
tatcggtgtgcatgtgcagccgatagaacagggcatgctatgctacacacactatatggt
caagcaatgaagcataatactcagttttttgttgaatattttgcactggaccttctcatg
gacaatgaaggcatctgccaaggtgtaattgcgctaaacatggaggatggtacccttcat
cgttttcgtgctgcaaatacaattctagccactggaggttatggtagagcctacttttca
gcaacttcagctcacacatgtactggtgatggcaacgctatggttgcacgtgccggatta
ccccttcaggatcttgagtttgtgcagttccatcctacaggcatttatggtgctggatgc
ctgataacagaaggttcccgaggtgaaggtggtattcttcggaacagtgaaggtgagaga
tttatggaacgatatgctccaactgctaaagatcttgcatctcgtgatgttgtttcgaga
tcgatgacaatggaaattagggagggccgtggtgtaggaccactgaaggaccatatctat
ctgcacctcaaccatcttcctccagaagttctcaaggaaaggcttcctggtatatctgaa
actgctgcgatttttgctggtgttgatgtcaccaaagagccgattcctgttttgcctact
gtgcactataacatgggtggtatcccaacaaactatcatggggaggtgctgcatatcaag
ggtgatgatccagatgcagttgttcctggtctgatggctgctggggaagctgcttgtgca
tctgttcacggcgctaacaggcttggtgcaaattcacttcttgatatagttgtatttggc
agggcttgtgcaaacagggttgctgagatatccaaaccaggagagaagcagaagcctctt
ggaaaaggtgttggagaaaatactattgcttggttggataagttgaggaatgcaaatgga
tctttacctacttcaaagattcgtctcaacatgcaacgggttatgcaaaacaatgctgca
gttttccgcacacaagaaactcttgaggaaggctgtgaactgattagcaaagcatgggag
agtttccatgatgtcaagatcagtgacagaagtctcatatggaattcagacttgattgag
accatagaattggaaaacctgctaataaatgcatgcataaccatgtattcagcagaggct
cgcaaagagagcagaggagctcatgcccgtgaagatttttcgacaagagatgatgagagc
tggatgaagcacaccctagggtattgggagaacgagaaggttagactagcctacaggcca
gttcacatgaataccttggacgatgaagttcaatctttcccaccgaaagcacgtgtttac
taa

DBGET integrated database retrieval system