KEGG   Shewanella bicestrii: CF168_01310Help
Entry
CF168_01310       CDS       T05197                                 

Definition
(GenBank) penicillin-sensitive transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00550  Peptidoglycan biosynthesis
sbj01100  Metabolic pathways
sbj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CF168_01310
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CF168_01310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbj01003]
    CF168_01310
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbj01011]
    CF168_01310
Enzymes [BR:sbj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CF168_01310
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CF168_01310
Glycosyltransferases [BR:sbj01003]
 Polysaccharide
  Bacterial polysaccharide
   CF168_01310
Peptidoglycan biosynthesis and degradation proteins [BR:sbj01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CF168_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ASK67597
UniProt: A0A220UHF5
LinkDB All DBs
Position
complement(277375..279894)
Genome map
AA seq 839 aa AA seqDB search
MKWLKRIVIALFSLALLGVGAIVAAYFYVLPDLPDVSTLKNVQLQTPLRIYSSDGKLISQ
FGEKRRIPLKLEEVPKPLLQAFLATEDARFYEHGGIDPVGVMRAAIVMLTTGEKKQGAST
ITMQVARNFFLTRDKTIIRKVKEIFISYHIEQLLTKDEILELYVNRIYLGQRAYGVGAAA
QVYFGKNVQDLTLSEMSMIAGLPKAPSTLNPITSPSRALARRNVVLMRMNEVGYISKAEY
QAAVQEPLVAKYHGAEIDLYAPYISEMARDYMVQKYGEEEAYTNGYNVYTTISSEQQLLA
QQALRNNVYAYDERHGYRGPAAVLWTDTKPDDAQIKAELAKITPVQELQPAAVLNIDGQQ
ASVLTAKGETKVIKWDGLKWARKFITDKRQGSVPKSASDMLKVGERIWIRDNGQYLQLSQ
VPEVASATVALDPTNGAIRTLVGGYSFSQSQYNRVTQAKRQLGSNIKPFIYAAALEKGFT
LATLINNAPINKPDISQGTAWRPKNSPDIYGGPTRLRVGLAQSINVMSVRAMRHIGLDAA
IAELTKFGFDPNDLPRNESLALGSPSVTPLQVATAFNVFANGGFLVEPFYIERVEDSFGN
VIEKANPTLACKPNNSSVQPSSDPMSFGEPTTQTDEPVAHCFEQTGRYAPQIISEQTAFL
ITEALKSVIWGGGDWSKGTGWQGTAWRAAQLIKRHDIAGKTGTTNESRDTWFSGFGPTLT
STFWVGFDDHGRQLGRTAWNSNGEKDQITGTEAGAKTAGPGWNEFMNNVLKGVPETTAIP
PEGIVSVRIDLATGKLTRKTDYTSAFEYFISGTEPKEYISESQDENNLFIDAPTDDLFQ
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggttaaaacgtattgttatagctctattcagtctagcccttttgggcgtgggc
gccattgttgcagcatacttttatgttttgccggatctgccggatgtatcgacactaaaa
aatgtgcaattacaaacacctttgcgcatttacagtagcgatggcaagctcatctctcaa
ttcggtgagaagcgtcgcattccgctgaaactcgaagaagtgcctaaaccgctgctccaa
gccttcctcgccaccgaggatgcacgcttttatgagcacggcggtatcgatcctgttggg
gtgatgcgtgccgcaatcgtcatgctcaccacaggtgaaaagaagcaaggcgcgagtact
atcaccatgcaggtggcgcgtaacttcttcctgacccgcgacaagaccattattcgtaaa
gtgaaggaaatttttatttcctaccacatcgagcaattgttaactaaagatgagatttta
gaactctacgttaaccgtatttatttaggtcagagagcctatggtgtcggcgcggctgct
caagtgtattttggtaaaaacgttcaagatctcacgctttccgaaatgagtatgatcgcg
ggcctccctaaagcaccgtcgaccctaaaccctattacctctccttcacgcgcactcgca
cgccgcaacgtggtattgatgcgaatgaacgaagtgggttacatcagcaaagctgaatac
caagctgctgtgcaagagccgctcgtcgccaaataccatggcgctgaaatcgacctttac
gccccttatatctctgaaatggctcgagattacatggtgcaaaaatacggtgaagaagag
gcctacacgaatggctataacgtctacaccacgatttcatcagagcagcaactgctagca
cagcaagcattacgtaataacgtctatgcctatgatgagcgccacggttaccgtggtcct
gcagcggttctttggaccgacaccaagccggacgatgcacaaatcaaagccgagctcgca
aaaattacgcctgtacaagagttgcaacctgctgcggtattaaacatcgatggtcagcaa
gccagcgtgttaaccgccaagggcgaaaccaaagtcattaagtgggatggcctaaaatgg
gcgcgtaaatttatcaccgataaacgccaaggctcggtgccaaaatcggcttcggatatg
ctaaaagtcggtgagcgcatttggatccgcgataacggtcagtacttacaattatcgcaa
gtgccagaagtggccagtgccactgtagcactcgatcctacaaatggtgctatccgaacc
ttagtcggtggctacagcttcagccaaagccaatacaaccgcgtgacccaagcgaaacgt
caattaggttcgaatattaaacctttcatctatgctgcggcattagagaaaggctttaca
ctcgcgactctgattaacaacgcgccgattaataaacccgatattagccaaggtactgcg
tggcgccctaaaaactcgcccgatatctatggcggtccgacgcgtctgcgtgtgggctta
gcgcaatcgatcaacgtaatgtcggttcgtgccatgcgccatattggtttagatgcggct
atcgccgaattgactaagtttggctttgatcctaacgacttacctcgtaacgagtcgtta
gccttaggttctccttcggtcaccccgttgcaagtggcaaccgctttcaacgtgttcgcg
aatggtggcttcttggttgaacctttctatatagaacgagtagaagactccttcggtaat
gtgattgagaaggcaaatccgactttggcctgtaagcctaacaacagctctgtgcagcct
agcagcgatccaatgagttttggtgagccaaccactcaaaccgatgaacctgtcgcccat
tgcttcgagcaaacaggccgttatgctccgcaaattatctctgaacaaacggcattcctg
atcaccgaagcgctgaagagcgtgatctggggtggtggcgattggagtaaaggcacaggc
tggcaaggtacagcctggcgtgctgcgcagttaatcaagcgtcatgatattgcaggtaaa
acgggcacaaccaacgaatcacgcgatacttggttcagtggttttggtccgacactgacc
agcaccttctgggttgggtttgatgaccatggtcgtcagttaggcagaaccgcatggaac
tccaacggtgagaaggatcaaatcacgggtaccgaggcgggcgctaagaccgcaggccca
ggctggaacgagtttatgaataacgtgctgaagggcgtacctgaaaccacagcgattccg
ccagaagggattgtctcggtgcggatcgatctggcgaccggcaagctgactcgcaagact
gactacactagcgcatttgaatactttatctcgggcactgaacctaaggaatatatcagt
gaaagccaagatgaaaacaacctattcatcgatgcgccgacagacgatttattccaatag

DBGET integrated database retrieval system