KEGG   Shewanella bicestrii: CF168_02450Help
Entry
CF168_02450       CDS       T05197                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00620  Pyruvate metabolism
sbj01100  Metabolic pathways
sbj01120  Microbial metabolism in diverse environments
sbj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CF168_02450
Enzymes [BR:sbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     CF168_02450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: ASK67804
UniProt: A0A220UHT0
LinkDB All DBs
Position
528595..529839
Genome map
AA seq 414 aa AA seqDB search
MSDIRQQALDYHEFPVPGKTAVCLTKPAETSHDLALAYSPGVAEPVREIAANPDNAYRYT
NKGNTVAVITNGTAILGLGNLGPLASKPVMEGKALLFKHFANIDSTDIEVTHNTTEEFIN
TVAAIAGTFGGINLEDIKAPECFVIERELIERCNVPVFHDDQHGTAIVTAAGMINALEIQ
GKLISDATFVCMGAGAAAIACMTMLVKCGANRANIYMLDTKGVIHTGRTDLNEYKALFAN
NTDKRTLQDVIKGADVFLGLSGPNVIGAEEVAMMADKPVIFACSNPDPEIKPELAHATRS
DLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASCINDEMKVAAVHAIAGLAKEEVPASV
LKAYPKVSSLSFGPEYVLPKPMDPRLLPRVARAVAQAAIDSGVAAITTLPHYAD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcgtcaacaagcactcgattatcatgaattccccgttcccggtaaaacc
gcagtctgcctcactaaacctgctgaaacgagccatgacctcgcgctagcctacagccct
ggtgttgctgaaccggtacgtgaaattgctgctaatcctgacaatgcctatcgttacacc
aacaaaggtaacactgtcgctgttatcactaacggcacggcgattctggggttaggtaat
ttaggcccattggcgtcaaaaccggtgatggaaggtaaggctctgttgtttaaacacttt
gcgaatatcgactcgaccgatatcgaagtgacccacaacaccactgaagagtttattaac
actgttgcggctatcgctggcacctttggtggtattaacctcgaagacatcaaggcgcca
gagtgctttgttatcgagcgcgaattaattgagcgttgtaatgtgcctgtgttccatgat
gaccagcacggcactgcgattgtgacggctgcgggtatgatcaacgccttagaaatccaa
ggcaaactgatcagcgatgcgacctttgtgtgtatgggggctggcgctgctgcgatcgcc
tgtatgaccatgctggtaaaatgtggtgcaaaccgcgccaacatctacatgttagatacc
aaaggcgttatccatacgggtcgtaccgatctgaatgaatacaaagccttgtttgcaaac
aataccgacaagcgcactttgcaagatgtgattaaaggtgccgacgtattcttaggttta
tctggccctaacgtgattggcgctgaagaagtggccatgatggcggataagccagtgatt
tttgcctgctcaaacccagatcctgaaatcaaacctgagcttgcccacgcgacgcgcagc
gatttaatcatgggtactggtcgcagtgattatccgaaccaagtgaacaacgttctgtgt
ttcccattcattttccgtggtgccttggatgtgcgtgcatcttgcattaacgatgaaatg
aaagtggctgcagtacatgcgattgctggcctagccaaagaagaggtcccagcgagcgtg
cttaaggcttatccaaaggtgagttcattaagttttggccctgaatatgtgctaccaaaa
cctatggacccacgtttattacctcgcgttgcccgcgcggtcgcgcaggctgcgattgat
tcgggtgttgcggcaatcactacgctgccacactacgccgattaa

DBGET integrated database retrieval system