KEGG   Shewanella bicestrii: CF168_04160Help
Entry
CF168_04160       CDS       T05197                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sbj  Shewanella bicestrii
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CF168_04160
Enzymes [BR:sbj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CF168_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO Glutaredoxin Thi4 NAD_binding_7 FAD_binding_3 AlaDh_PNT_C K_oxygenase Spermine_synth FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASK68129
UniProt: A0A220UJ13
LinkDB All DBs
Position
complement(946157..947734)
Genome map
AA seq 525 aa AA seqDB search
MLDANLKNQLQTYLQNLKRPVELVVSADESRKSQELNSLANDIVSLSTLVSLKEAQGPRT
PAMTVVNPELNTQISFAGLPMGHEFTSLVLALLHTGGHPIKLSDEIIEQIRNLPGKYEFE
TYVSLTCQNCPDVIQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGVVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGAKLRSRTILLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIHIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSVPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETTATKAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatttaaaaaatcaactgcaaacctatctgcaaaacctcaagagacca
gttgaacttgtcgtgtcagcagatgaaagtagaaagtctcaagaattaaacagcttagcc
aatgacatcgttagcctttcaacattagtgagcctcaaagaagctcaaggcccccgcacg
ccagcgatgacagtggttaacccagaactcaatactcagattagctttgctggtctgcct
atgggtcacgaatttacctcactcgtgttagccctgctgcacacgggtggacaccccatc
aaactcagcgacgaaatcattgagcagatccgtaatctgcctggcaaatatgagtttgaa
acctatgtgtcactcacctgccaaaactgccctgatgtgattcaggcgctgaatatgatg
gcggcgattaacccaaacatcaccaacgtgatgatcgacggcgccctgttccaagatgaa
gttgccagccgcaatatcatggccgtaccgtctgtgtacttgaacggtgaagtctttgcc
gccggtcgcatcagcattggtgagatcttaaataaactcgatactggcgcggccagccgc
aaagcggaagaactcagccaaaaagccccatacgaagtcttagtcgtcggtggtggcccc
gctggtgctgcggcagcgatttacgctgcccgtaaaggtctgcgtactggagtggtggcc
gataaattcggtggccaagtcgccgaaaccgtcgggatcgaaaactttatttcggttaaa
gcgactgaaggtccaaaactggtggctaaccttgaagcccatgtgcgtgactatgaagtc
gatatcatggataaccaaaaagccgttaaactggcgagcgatggtttattcgaactcgaa
ctggcaagcggcgctaaactgcgcagccgtaccatactactggcaaccggtgcccgctgg
cgcgaaatgaatgtccccggcgagaaagaataccgcggtaaaggcgtagcctactgccca
cactgtgacggcccattatttaaaggcaaacgtgttgcagtgatcggtggcggtaactca
ggtatcgaagcagccatcgacttagccaacatcgttgagcatgtcacagtactcgagttc
gacagcaaactgcgcgccgatgatgtgctgcaacgtaaagcggcctctatgggtaatatt
catattattactcaggcgatgaccactgaagtgactggtgatggtacccgtgtaaacggc
ctgaactacaccgaccgtgcaacgggtgaaagccatcatatcgcgttggcaggtatcttc
gtccaaatcggtttagtgcccaatgccgaatggttaaaaggcactgtggatttgactcct
cgcggcgaaatcatcgtcgatgagcgcggccagacctcagtaccaggcgtatttgccgca
ggtgacgtgacgaactcaccttacaagcaaatcatcatcgccatgggtagcggtgccaat
gcctcactgggtgcatttgattacttaattcgccatagcgatgacagtaccgaaaccaca
gcgactaaagcggcttaa

DBGET integrated database retrieval system