KEGG   Shewanella bicestrii: CF168_07160Help
Entry
CF168_07160       CDS       T05197                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sbj  Shewanella bicestrii
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbj02000]
    CF168_07160
Transporters [BR:sbj02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CF168_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N SbcCD_C DUF4162 AAA_15 CysG_dimeriser AAA_23 PALP Mg_chelatase AAA_22 AAA_28 Rad17 AAA_16 AAA_29
Motif
Other DBs
NCBI-ProteinID: ASK71227
UniProt: A0A220USR5
LinkDB All DBs
Position
1647433..1648407
Genome map
AA seq 324 aa AA seqDB search
MASEFAIETRGMTRAFGGINAVEDLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLLSPTS
GDIRVLGETLPGAEEKLRRRIGYMTQKFSLYDNLSVRENLEFVAQIYGLNRRQTKARLAE
LLSLYDLAGREKQMAGSMSGGQKQRLALAAATLHHPELLFLDEPTSAVDPENRREFWERL
FDLCAQGTTILVSTHYMDEAERCHGLAILERGIKRADGSPQQLMAAMGARVIEVSGEDLR
KLKQSLISDANVLSAAQIGSRLRVLVQSSIADPLAWLSPRVAGRALTEVRPSLEDVFVTC
TGGRAQLTPPNGSQATTVEAQDVT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggcttctgagtttgctatcgaaacccgcggcatgacccgcgcctttggcggcatcaat
gcggtcgaagatctcgatttagctatccctaagggcacgatttatggatttttaggcccc
aatggttgcggtaaatcgacctccattcggatgttgactgggctgctgagtccgacctcg
ggggatattcgggtgctgggcgaaaccttgcccggcgccgaggaaaaactgcgccgccgc
attggctatatgacgcaaaaattctccctctacgacaatttgtcggtgcgggaaaacctt
gagtttgtggcacaaatttatgggctgaatcgtcgccaaaccaaggcgcgtttggccgag
ttattaagcctttacgatttggcggggcgcgagaagcaaatggcgggctccatgagtggt
gggcaaaaacagcgtctagccttggccgccgcgaccttacatcaccccgaactgttattt
ctcgatgagccgacgtcggcggtggaccctgaaaatcgccgcgagttttgggaacggctg
tttgacctctgtgcccaaggcaccacgattttagtctcgacccactatatggatgaggcc
gagcgttgccatggtttagcgattttagagcgcgggataaaacgcgccgacggctcgccg
caacaacttatggcggccatgggcgcgcgggtcattgaagtgtcgggggaggatttacgc
aagcttaaacagtcgcttatcagcgacgccaacgtgttatctgcggcgcagattggcagt
cgtttacgggtattggtgcaaagttcgattgcagatccgctggcttggttaagtccaagg
gttgcggggcgggcgctgaccgaggtgcgtccaagccttgaggatgtgtttgtgacttgc
acggggggacgtgcccagctaacgccgccaaacggcagtcaggccacgacagtggaggct
caagatgttacgtag

DBGET integrated database retrieval system