KEGG   Shewanella bicestrii: CF168_07240Help
Entry
CF168_07240       CDS       T05197                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sbj  Shewanella bicestrii
Pathway
sbj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CF168_07240 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbj02000]
    CF168_07240 (pstB)
Enzymes [BR:sbj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     CF168_07240 (pstB)
Transporters [BR:sbj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CF168_07240 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_23 ABC_ATPase AAA_29 AAA_15 AAA_16 AAA_30 Rad17 NB-ARC AAA_33 AAA_25 AAA Adeno_IVa2 AAA_18
Motif
Other DBs
NCBI-ProteinID: ASK68693
UniProt: A0A220ULZ0
LinkDB All DBs
Position
1665243..1666061
Genome map
AA seq 272 aa AA seqDB search
MISIDSTAMKTNNFDLANLSQNDTALEIRNLDLRYGDKQALFNVSMKIPKKQVTAFIGPS
GCGKSTLLRCINRMNDLVDNCHIDGEILLHGQNIYDKKIDVAALRRNVGMVFQRPNPFPK
SIYENVVYGLRLQGINNRRELDEAAERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIA
RAIAIEPEVLLLDEPTSALDPISTLTIEELITELKTKYTVVIVTHNMQQAARVSDQTAFM
YMGELVEYADTNTIFTTPKKRKTEDYITGRYG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatttctatagattcgacagccatgaaaaccaacaactttgacttagcaaacttgagc
cagaacgataccgcactggagatccgcaacttagacctgcgctatggcgacaagcaagcg
ctgtttaatgtgtcgatgaagatcccgaagaagcaagttacggcgtttatcggccccagc
ggttgtggtaaatccaccttattgcgctgcattaaccgcatgaacgatctggtcgacaac
tgccatatcgacggcgagattttgctgcacggtcaaaatatttatgacaaaaaaatcgac
gttgccgccctgcgccgcaacgtaggtatggtgttccagcgtcctaacccattccctaag
tcgatttacgaaaacgtggtttatggtctgcgtctgcagggcattaacaaccgccgtgaa
ctcgatgaagcggccgagcgttcgctacgcggcgcggcgatttgggatgaagtgaaagac
cgtctgcacgataacgcctttggcttatccggtggtcagcagcaacgtctggtgattgcc
cgtgcgattgccatcgagccagaagtattactgctcgacgaaccgacttcggccctcgac
ccgatttcaaccttaaccatcgaagagctgatcactgagcttaagactaagtacacagtg
gttatcgtgacccacaacatgcaacaggcggcgcgggtgtcggaccaaacggcctttatg
tatatgggcgaattggtggaatacgccgataccaacaccattttcaccacaccgaaaaaa
cgtaagaccgaagattacattaccggccgttacggttaa

DBGET integrated database retrieval system