KEGG   Shewanella bicestrii: CF168_07465Help
Entry
CF168_07465       CDS       T05197                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00250  Alanine, aspartate and glutamate metabolism
sbj00410  beta-Alanine metabolism
sbj00430  Taurine and hypotaurine metabolism
sbj00650  Butanoate metabolism
sbj01100  Metabolic pathways
sbj01110  Biosynthesis of secondary metabolites
sbj01120  Microbial metabolism in diverse environments
sbj02024  Quorum sensing
Module
sbj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CF168_07465
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CF168_07465
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CF168_07465
   00430 Taurine and hypotaurine metabolism
    CF168_07465
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CF168_07465
Enzymes [BR:sbj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CF168_07465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ASK68734
UniProt: A0A220UKG7
LinkDB All DBs
Position
complement(1713950..1715599)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQAIASEESLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPSQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYAQNDDFYCNWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGDFKGVTREGLIKALRHYGFDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDGNNKVDVAKMREVAAELANKRIKVMAIVGVAGTTETGNIDPLRELAALATEL
NCHFHVDAAWGGASLLSNKYRHLLDGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIDAHPDFELVTAPELCLLTYRYVPTNVQAAMQVAIQQGDKTKLARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIAALDKEFL
PALLAMVNE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgccaagccatcgcatccgaagaaagtctaatgcggattttc
actgtgcccgaagatgcggaatccaccttaagcattatcgagcagaagctttccgaggac
ttagcgggttttttgggtgacagcattgccgcgctagaaaagccgctctccgaaatcgag
accgattttcaagcctttgaaattccaagccagccgcgttttgtctccgactacaccgac
gaaatcatgcagaatctcgtggcgcattcggtgcatacggcggcgcccagttttatcggc
catatgacctcggcactgccctatttcgtgttgccactgtcgaaaatgatggtggggctg
aatcaaaacttggtcaaaatcgaaacctccaaagcctttacaccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgctcaaaacgatgatttttattgtaattggatg
cacagcgccaaccattccctcggcgcattttgctcaggcggcactgtggctaacatcact
gccctgtggattgcccgcaaccaattactcaaggccgatggcgactttaaaggcgtgacc
cgcgaaggcttaatcaaggcgctgcgccactatggcttcgatgatttagcgattctggtc
tccgagcgcggccactactccttaggtaaggccgtcgatctgctcggtatcggtcgcgac
aatatcatcagcatcccaaccgatggcaataacaaagtcgacgttgccaaaatgcgcgaa
gtcgccgccgaactggcgaataagcgcatcaaagtcatggcgattgttggggtggctggc
accaccgagacgggcaatatcgacccattgcgcgaacttgccgccttagcaactgagcta
aactgccacttccatgtggatgcagcttggggcggcgcaagcttattatccaataaatac
cgtcacttactcgatggtattgaactcgctgactcagtcaccatcgatgcccataagcaa
atgtatgtccccatgggcgcgggtatggtgctgtttaaaaatcctgagtttgcccatgcg
attgcccaccacgccgaatatattttgcgccgaggctctaaggatttaggcagccaaacg
ctcgaaggctcacgccccggcatggcgatgttagttcatgcctgtttgcagattattggc
cgcgatggttacgaaatccttatcaataacagccttgaaaaagcccgttattttgccgag
caaatcgacgcacaccctgactttgaactggtcaccgcgccagagctatgcctgctcacc
tatcgttatgtgccaacgaatgtgcaggcggcgatgcaagtggcgattcaacaaggcgat
aagaccaaactcgctcgctttaatgagctgctcgatggtctaacccaatttattcaaaaa
caccaacgcgaacagggtaaatcctttgtctcgcgcacccgcattcaacccgcccgctac
tttaggcaacccacagtggtgtttcgcgtggtattagctaatccgttgactagccatgag
attctgaatcaagtgcttatcgagcaaggtgaaattgccgcattggataaagagttttta
cctgcgctattagctatggtcaatgaatag

DBGET integrated database retrieval system