KEGG   Shewanella bicestrii: CF168_09980Help
Entry
CF168_09980       CDS       T05197                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sbj  Shewanella bicestrii
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sbj01002]
    CF168_09980
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbj04147]
    CF168_09980
   04090 CD molecules [BR:sbj04090]
    CF168_09980
Enzymes [BR:sbj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CF168_09980
Peptidases [BR:sbj01002]
 Metallo Peptidases
  Family M2
   CF168_09980
Exosome [BR:sbj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CF168_09980
CD molecules [BR:sbj04090]
 Proteins
  CF168_09980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ASK69172
UniProt: A0A220UMR2
LinkDB All DBs
Position
complement(2273621..2275483)
Genome map
AA seq 620 aa AA seqDB search
MAILLNRPTTLALTIALTLGLTACNDAQSKAETTAAAPAATNAAPDKAQAIAFIQDAEAH
MAQLSIEANRAEWIYSNFITEDTAALSAAVGEKVSAASVKFATEAAKYANVELDPANSRK
LNILRSALVLPAPLDPVKNAELAQISSELNGLYGKGKYCFADGKCMTQPELSNLMAESRD
PAKLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANLSELWRSQYDMKPDEFSQEL
DRLWGQVKPLYESLHCYVRGELNNEYGDAIAPKTGPIPAHLLGNMWAQQWGNVYDLVAPD
DADPGYDVTELLEQKGYDEHKMVKQAESFFTSLGFAPLPDSFWSRSLFLQPKDRDVVCHA
SAWDLDNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKQQPFLFKNSANDGFHEAIG
DTIALSITPSYLKQIGLLEDVPDASKDIGLLLKQALDKIAFLPFGLMIDQWRWKVFSGEI
TPAQYNQAWWELREKYQGVKAPTDRSEADFDPGAKYHVPGNVPYTRYFLAHILQFQFHKA
LCDTAGDKGPVHRCSIYGNQAAGEKLNKMLELGASQPWPVALKEVTGTEGMDAKAVLDYF
APLKTWLDEQNTAANRQCGW
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggctattctattgaatcgtcccaccactcttgcgcttaccatagcgctaaccttaggc
ctaaccgcctgtaatgatgcccaaagcaaggccgaaaccactgcagcagcacctgctgca
actaatgctgcgcccgataaagctcaggccatcgcctttattcaagatgctgaagcccac
atggcgcagctctctatcgaagcgaatcgcgccgaatggatttacagtaacttcatcacc
gaagataccgctgcactctcggccgcagttggggaaaaagtcagtgccgcgtcggtcaaa
ttcgccaccgaagccgccaagtacgccaatgtggaactcgatcctgccaattcgcgcaaa
ctgaatattctgcgcagcgcactcgtgttacctgcgccgcttgatcccgtcaaaaatgct
gagctggcgcaaatcagctccgagctcaatggactctatggtaaaggcaaatactgtttc
gccgatggcaagtgtatgacccagccagagctgtcgaacctgatggcggaatcgcgtgac
ccagccaaactgcttgaagcatggaaaggttggcgcgaaattgcaaaaccgatgcgccca
ctatttcaacgtgaagttgaactagccaacgaaggtgcaaaagatctaggttacgctaac
ctctctgagttatggcgcagccaatacgatatgaaacccgatgaattttcacaggagtta
gatcgtttatggggacaagttaagcccctctatgaatccctgcattgttacgttcgcggc
gagctgaataacgaatacggtgatgccatcgcgccaaaaaccggccctattcccgcacac
ttactgggaaatatgtgggcgcagcaatggggcaatgtgtacgatctcgtcgcccctgac
gatgccgatcctggctatgatgtgacggaattgctcgagcagaagggctatgatgaacac
aagatggttaaacaggccgaaagctttttcacctcgttaggctttgcgccgctgccagac
agtttctggagtcgctctttattcttgcaacccaaggatcgtgatgtcgtttgtcatgcc
tcggcgtgggatttggataacctcgacgatattcgcatcaagatgtgtatccagaaaacc
gctgaagactttaccgttattcaccacgaacttgggcacaacttctatcaacgtgcctat
aaacagcagcctttcctgtttaaaaacagtgccaatgatggtttccatgaggccattggt
gacacgatcgcgctatctattaccccaagctatctaaaacagattggtttgctcgaagac
gtgcccgatgcttccaaggatattggcttactgctgaaacaagctttagataaaatcgcc
ttcctgccctttggtttgatgattgaccagtggcgctggaaagtctttagcggtgaaatc
actccagcgcagtataaccaagcctggtgggaattaagagagaaataccaaggcgttaag
gcgccaacggaccgcagcgaagccgattttgatccaggtgccaagtaccatgtgcccggt
aacgtgccttatacgcgctacttcctcgcgcatattctgcaattccagttccataaggca
ctgtgtgataccgccggcgataaaggacctgtacacagatgcagtatttatggcaatcaa
gccgctggggaaaaactcaataaaatgttagagctaggtgcaagtcaaccttggccagtt
gctttaaaagaagtgacaggtactgagggaatggatgccaaagccgtactcgattatttt
gcgccgcttaaaacctggctcgatgagcaaaacacagcggcgaatcgtcaatgtggttgg
taa

DBGET integrated database retrieval system