KEGG   Shewanella bicestrii: CF168_11085Help
Entry
CF168_11085       CDS       T05197                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00500  Starch and sucrose metabolism
sbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CF168_11085
Enzymes [BR:sbj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CF168_11085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 DUF1793
Motif
Other DBs
NCBI-ProteinID: ASK69371
UniProt: A0A220UN69
LinkDB All DBs
Position
2534212..2536728
Genome map
AA seq 838 aa AA seqDB search
MASTTVPSQQARSLTHRRNLTRKPIALAIAASLIGVASLTGCPPSAPNADTSTPTVTKAT
DAQIAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDSAQNPISRVWFSVAQGILTETMY
GLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINRDVEGKYQ
IEKHIFTDPDRDTLMMHVTFTAFEAGITPHLYVNPHIDNAGANDIGRIDHQALIARTNDP
HSSVMTVKSDIDFAQATTGFVGVSDGLADLADNGKLDTLYQATSSAENPTQGNIAFTASY
PALQANQPLNVNLAIGFGHDETSSLANANASLTAGYDAVLSQYNAGWHSYLQSLPAMPDM
ARSTTDNGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGDTVPAVTPSTGYKAVWPRDFY
QCAMAFLAMGDTQTPKVAFEYLKKVQVSDKTPGYSGTPGWFLQKTHVDGQIEWVGVQLDQ
TAMPIMLGWKLWQAGVLSQAELSHWYQEMLKAAADFLVSGGEVNLDWNNTQITPPKTQQE
RWEEQAGYSPSTTAAVIAGLVAASDIAKAVNDSDASQRYLATAKTLNQQLEKYLVTTQGL
LTDSQGIKAPYYLRLSPNGEPNTAEQLAANNGRAGLDQRQILDGGFLELVRYGVRGATDK
LINQSLALVDNTELEDNLRLKYNFTAKDGSSVPGFRRYGNDGYGEDTLTGANYAESGSNS
DNQRGRVWPFFTGERGHFELALASAKGELSGTHAQQTKQQLINTYVQGMETFANAGLMLP
EQAWDGVGNATRYQYQLGQGTNSATPLAWTHAEYIKLVRSMSDGRVWDNYPIVPEALK
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgacaacagtaccttcacagcaggctcgcagcttaactcaccgccgcaactta
actcgtaagccgattgcgctcgcaattgccgcaagccttatcggcgttgccagcttaacg
ggctgcccaccctcggcccccaatgcagacacatcaacaccgaccgtcaccaaagccaca
gacgcacagattgcccccggcgcccccggcaaagccccaacctgggcgttttccggcaaa
accggtatcggtacctcctatgagccttatactcaggggcaataccaagacagcgcgcaa
aatcccattagccgagtgtggttctccgtcgcgcaggggattttaaccgagaccatgtac
ggccttattcacaacgctcagctcaaagagttgcaatttgtgatcactggcaatggcttt
gtcgataccgaaaaagacaacacgatcagcagcattgaatacttagataccgatgccaat
ggccgcccacaatccttggcctataagattatcaatcgcgatgttgaaggtaagtatcag
atagaaaaacatatctttaccgatcccgaccgcgataccctgatgatgcacgtgacgttt
accgcctttgaagcaggcatcacaccgcatttatacgttaacccccatatcgataatgcg
ggcgcgaatgatattggcagaatcgatcatcaagcccttatcgctcgcaccaatgatccc
cacagcagcgtgatgacagttaaatcggatatcgattttgcgcaggcgaccacgggcttt
gttggtgtatccgacggtttggccgatttagccgataacggcaagctcgatacgctgtat
caggccaccagcagcgccgaaaatcctactcaaggcaacattgcttttaccgccagttat
cctgcactccaagctaatcaacctcttaatgtgaatttggcgattggttttggccatgat
gaaacgagcagtttagccaatgccaacgccagcttaacggcggggtatgacgctgtgctg
agccaatacaacgccggttggcacagttatttacaatcgctgcccgcgatgcctgatatg
gcgcggagcaccacagataatggcaagctgctgtataccagtgccatggtactgaaggcg
caggaagataaaacctatgcgggcgcccttatcgcgtcgctttctaatccttggggcgat
actgtccctgctgtcacacccagcacgggttacaaggccgtttggccccgagacttttac
caatgcgccatggcatttctcgccatgggcgatacgcaaacgcctaaagtcgcctttgag
taccttaaaaaggtgcaagtgagtgacaaaactccaggctatagtggcacgcccggttgg
ttcttacaaaagacccatgtggatggccaaatcgaatgggtaggcgtacagctcgaccaa
acggcgatgccgatcatgctcggctggaaactctggcaagcaggcgtgcttagtcaagct
gagctgagccattggtatcaagagatgctaaaagccgcggcggactttttagtcagcggc
ggcgaggtcaatctcgactggaataacacgcaaattacgccaccgaaaacccagcaagaa
cgttgggaagaacaagctggttattcgccctccaccacggccgcagtgatcgcaggctta
gtggccgcgagtgatattgctaaggcagtaaacgacagcgatgccagtcagcgttatctc
gcaaccgctaaaacgcttaatcaacaacttgaaaaatacttagtgacgacccaaggtttg
cttaccgatagccaaggcattaaggcgccttattatctgcgattaagccccaacggtgag
ccaaacaccgccgagcaactcgccgctaataatggtcgtgcgggattagatcaacgtcag
atcctcgatggcggctttttagagttggtgcgctacggcgtacgtggcgccaccgataag
ctgattaatcaaagcctagcgctggtggataataccgagcttgaagacaatttacgcctc
aaatacaactttacagcaaaagatggcagcagcgttcccggctttagacgctacggtaac
gatggctacggtgaagataccctcactggcgcaaactacgccgaatcgggcagtaatagc
gacaaccaacgcggccgcgtctggcccttcttcaccggtgagcgtggccattttgaattg
gccctcgccagcgctaagggagagctaagcggtactcacgcgcagcaaaccaaacagcag
cttatcaatacctatgtgcaaggtatggaaaccttcgccaacgcgggtctgatgctcccc
gagcaagcgtgggacggtgtgggtaacgccacacgttaccaatatcaactcggccaaggc
actaactccgccaccccgctcgcctggacccacgctgaatatatcaagctggtgcgttcg
atgagcgatggtcgagtctgggataactacccaatcgtcccagaagcgttgaaatag

DBGET integrated database retrieval system