KEGG   Shewanella bicestrii: CF168_12525Help
Entry
CF168_12525       CDS       T05197                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sbj  Shewanella bicestrii
Brite
Enzymes [BR:sbj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CF168_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASK69624
UniProt: A0A220UN20
LinkDB All DBs
Position
2888361..2888945
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFAGKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacctacgttgttaagctaaac
ggtttgatcgaaggaaccgatttcgcaggtaaatctttagaagaaatcatcaagacttct
actggtggcgtatttaacaacgcagctcaagtttggaaccacactttctactggaactgc
ttagcgcctaacgctggcggtgagccaacaggtcctgtggctgatgcaatcaatgctgca
ttcggttcattcgacgcattcaaagcacaatttaccgattctgcggtaaacaactttggt
agcgcttggacttggttagtgaaaaaagccgatggcactgttgctattgttaacactagc
aatgctgcaacccctctgactgacagcactgtaacaccaatcctgactgttgacgtgtgg
gaacacgcttactacatcgattaccgcaacgtacgtcctgactacttagcccacttctgg
caattagttaactgggacttcgtgaaccaaaacttcgctggttaa

DBGET integrated database retrieval system