KEGG   Shewanella bicestrii: CF168_13155Help
Entry
CF168_13155       CDS       T05197                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbj01100  Metabolic pathways
sbj01110  Biosynthesis of secondary metabolites
sbj01130  Biosynthesis of antibiotics
sbj01230  Biosynthesis of amino acids
sbj02024  Quorum sensing
Module
sbj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CF168_13155
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CF168_13155
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CF168_13155
Enzymes [BR:sbj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CF168_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ASK69730
UniProt: A0A220UP04
LinkDB All DBs
Position
3034706..3036415
Genome map
AA seq 569 aa AA seqDB search
MTLKTFNQVTQVDGENVASSQQTFARSHTLKATLAYHSDPLRLYQHITQDAPHTMLLESA
EIDSKENLKSMVMTHAALMIRCDGYRLRFSALSDNGISLLVPIEQFFTARASQTQCQLDG
NNLVVTLQKDTELKDEDARLKSTSPLDGLRLFVKHIDCGAHTDSQSKPAFEDLFLGGVLS
YDLIDTVEPLPEAPNGANDCPDYLFYLAETLILIDHKQKQAEIITHNFSEGSAKQVEVTQ
ALAERAENIRAQCEALVKSAMPAPALIGITAKEQVNVSDEDFKQTVIDLKEHIIAGDIFQ
VVPSRNFSLPCPNTLGAYRALRLTNPSPYMFYFRGHDFTLFGASPESALKYEASNNQVEV
YPIAGTRKRGKTASGEIDFDLDSRIELELRLDKKELSEHLMLVDLARNDIARISQSGSRK
VAELLKVDRYSHVMHLVSRVTGQLRQDLDALHAYQACMNMGTLVGAPKVRASQLVRQAEK
TRRGSYGGAVGYLNALGDMDTCIVIRSAFVKNGVAHIQAGAGVVFDSDPQSEADETRQKA
QAVISAIKMGAGLDDSHQATTTTTTEQQR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaccctaaagacatttaatcaggttacccaagttgatggcgaaaatgttgcctcgtct
caacagacattcgcacgttcacatacgctcaaggcgacgctggcataccatagcgaccca
ctgcgtctgtaccagcacatcactcaagatgcgccccataccatgttgttagaatcggcg
gaaatcgacagcaaggaaaatcttaagagcatggtgatgacccatgcggcgctgatgatc
cgctgcgacggttatcgtttacgctttagcgcactgagcgacaatggcatcagtttactc
gtccccatcgagcaattttttactgctcgcgcaagccaaactcaatgtcaactcgatggc
aacaacctagtggtcacgctacaaaaagatactgagcttaaggatgaggatgcgcgctta
aaatccacctcgcccctcgatggtttacgcttgtttgtaaagcatatcgactgcggcgct
catactgatagccaatccaagccagcattcgaagacttatttttaggtggcgtgctctcc
tacgatttgattgataccgtcgagccactgcctgaagcaccaaatggtgcaaatgattgt
cctgattatttattttatctcgccgaaaccttaattcttatcgatcacaaacaaaagcaa
gccgagatcatcacccacaacttcagtgaaggttcagcaaaacaggttgaagtgacccaa
gccttagccgagcgagcagagaatatccgcgcccaatgtgaagccttagttaagagtgca
atgcctgcgcccgccctcattggcataacggccaaagagcaagtgaatgtcagtgatgag
gacttcaagcaaaccgttatcgatttaaaagaacacattattgctggcgacatcttccaa
gtcgtgccttcacgtaactttagcctgccctgccccaataccttgggagcttaccgcgca
ctgcgtttaaccaaccccagcccctatatgttttatttcaggggccatgacttcaccctg
tttggcgcctcgcccgagagcgcgctgaaatatgaagccagcaataatcaggtcgaagtc
tacccgattgcaggcacccgtaagcgcggcaaaaccgccagtggcgagatcgatttcgac
ctcgatagccgtatcgaactcgaattgcgtttggataaaaaagagctctccgaacattta
atgttggtcgatttagcccgtaacgatatcgcccgtatcagccaaagtggcagccgcaaa
gtggccgagttacttaaagtcgaccgttattcccacgtgatgcacttagtcagccgcgtc
acaggtcaactacgccaagacttagatgcgctccacgcctaccaagcctgtatgaatatg
ggcacgctagttggcgccccgaaagtgcgcgcctcgcaattggtgcgtcaagcagaaaag
acccgccgcggcagctacggcggcgccgtgggttacctcaacgcccttggggatatggac
acctgtatcgttatccgctccgcctttgtgaaaaacggcgtggcccatatccaagcgggt
gctggcgtggtgtttgactccgatccccagagtgaagccgatgaaacccgccaaaaggcg
caggcagtgatttcggccatcaagatgggcgctggcttggatgacagccatcaagcgaca
acgaccactacgactgaacaacaaagataa

DBGET integrated database retrieval system