KEGG   Shewanella benthica: SHEWBE_2498
Entry
SHEWBE_2498       CDS       T06707                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbk  Shewanella benthica
Pathway
sbk00473  D-Alanine metabolism
sbk00550  Peptidoglycan biosynthesis
sbk01100  Metabolic pathways
sbk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SHEWBE_2498 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SHEWBE_2498 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SHEWBE_2498 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbk01011]
    SHEWBE_2498 (ddl)
Enzymes [BR:sbk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SHEWBE_2498 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sbk01011]
 Precursor biosynthesis
  Amino acid ligase
   SHEWBE_2498 (ddl)
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Other DBs
NCBI-ProteinID: SQH76461
UniProt: A0A330M2N9
LinkDB
Position
SHEWBE:complement(2369343..2370353)
AA seq 336 aa
MSQTNLLLICGGGGDEHAISLMSAKFFETSLAKLAHINLLKVELDAQGHYRTSDGELCEL
TNRKQIRFDDDNKACWPVDYVIPCIHGYPGETGDIQSYFELINLPYFGCDSEASRNCFNK
VTAKMWFSALGIPNTPYIFLNDFNDDAIAQAQQALVSWGSIFIKAASQGSSVGCYRVDSP
EELTESLQQAFTYSPYVIIEKTIEARELEVAVYEKDGEIIATQPGEIICATNTFYSFDEK
YAENSQAETKVVADISESVSLRIREYAVKVFKGMKLSHLSRIDFFLTEDNEILLNEINTF
PGLTPISMFPKMLQHHGDDFSDYLSHNIMQQLNKKA
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgagccaaacaaatctactgttaatatgtggtggcggtggagatgaacacgcgatctca
ctgatgtcagccaaattttttgaaacatcactggccaaattagcccatataaacctatta
aaagtcgaactcgacgctcagggccattatcgaacgagtgacggtgaactctgtgagcta
accaatcgtaaacagatacgtttcgatgatgacaataaggcgtgctggccggtagattac
gtcattccctgcattcacggttatccgggagaaaccggtgacattcaatcctatttcgag
ctgatcaacttgccctatttcggttgcgattcagaagcgagccgtaattgcttcaacaag
gtcaccgccaagatgtggttctcggcgcttgggatccccaataccccctatattttcctc
aatgactttaatgatgacgccatagctcaagctcagcaggctttggtctcttggggctcg
atattcatcaaggccgcgtcacaaggatcatctgtaggttgttaccgtgtagacagccca
gaggaattaactgagtctttgcaacaagctttcacctattcgccctatgtcatcatcgag
aagaccattgaggccagagagctggaagtggccgtatatgagaaagatggcgagattatc
gcgactcaaccaggtgagatcatctgtgcgacgaataccttttatagtttcgatgaaaag
tacgccgagaacagtcaagccgaaaccaaggtggttgccgatatcagtgagagtgtcagc
ctgagaatccgtgaatatgctgtcaaggtattcaagggaatgaaactcagtcacctgtca
cgtatcgacttcttcctcaccgaggacaatgaaattctcctcaatgaaattaataccttc
ccagggctcactcccatctccatgttccccaagatgttacaacaccatggtgatgatttc
agtgattacctcagccacaacataatgcagcaactcaataaaaaagcttaa

DBGET integrated database retrieval system