KEGG   Shewanella baltica OS155: Sbal_1574Help
Entry
Sbal_1574         CDS       T00478                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00250  Alanine, aspartate and glutamate metabolism
sbl00410  beta-Alanine metabolism
sbl00430  Taurine and hypotaurine metabolism
sbl00650  Butanoate metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
sbl02024  Quorum sensing
Module
sbl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Sbal_1574
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal_1574
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal_1574
   00430 Taurine and hypotaurine metabolism
    Sbal_1574
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal_1574
Enzymes [BR:sbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sbal_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 LmjF365940-deam P53_tetramer
Motif
Other DBs
NCBI-ProteinID: ABN61088
UniProt: A3D2X5
LinkDB All DBs
Position
complement(1831801..1833450)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGSDNKVDVAKMRQAALELARKNIKVLAIVGVAGTTETGNVDPLTELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHEDFELVTEPELCLLTYRYVPARVQAAMKLACEQADTIRVARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLIEQSEIAALDNEFL
PALMAMVAQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaactccctcgccaagccacagcatccgaagaaagtctgctccgcattttt
actgcaccggaagatgcaggatcaacgctgagtattatcgagcagaagctctccgaggac
ttagcaggctttttgggtgacagtatcgccgcgctcgaaaaacccttgtcggaaattgaa
accgattttcaagcctttgagatcccaactcagccgcgttttgtttccgattacaccgac
gaaattatgcaaaatctggtggcgcattcggtacacacagcggcaccaagttttatcggc
cacatgacgtcggcactgccctactttgtgttgccgctgtcgaaaatgatggtgggactc
aatcaaaatctggtcaaaatcgaaacctcaaaggcatttacgccgcttgagcgccaagtg
ctcggcatgatgcaccatttgatttacgaccaagatactgatttttatcaaagctggatg
cacagcgccaatcattccctcggagcattttgctccggcggcacggttgccaacatcacc
gccctgtggattgcccgtaaccaattattgaaagccgatggtgagtttaaaggcgtcagc
cgcgaaggcttactcaaggcactgcgccactatggctatgacgatttagcgattttggtc
tccgagcgaggtcactattcgcttggcaaagccgtcgatctgcttggtatcggccgcgac
aatatcatcagcattcccacaggcagcgataacaaggtcgatgtcgcgaaaatgcgccaa
gccgcccttgaacttgcccgtaaaaacatcaaggtgttggcgattgttggtgtggctggc
accactgaaaccggtaatgttgacccactgacagagttagcggcgctcgcaaaagagtta
aattgccatttccatgtggatgcggcgtggggcggcgcaagtttattatccaataaatac
cgccacttactcgctggtatcgaacttgccgattcagtcaccatcgatgcccacaaacaa
atgtacgtgcctatgggcgcgggcatggtgttatttaaagatccagagtttgcccacgcc
attgcccatcacgccgaatatattttgcgacgtggttcaaaggacttaggcagccaaacg
ctggaaggttcacgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
cgcgatgggtatgaaatattaattaacaacagccttgaaaaagcgcgctattttgcagag
caaatcaaagcccatgaggattttgagctcgtcactgaaccagaactgtgtctgctgact
tatcgttatgtccccgcccgcgtacaagccgccatgaagctggcctgtgagcaagcagac
acgataagagtcgcccgctttaacgagttgctcgatggcctcactcagtttattcaaaag
caccaacgcgaacagggtaaatccttcgtctcccgcacccgcattcagcctgcccgctac
tttaggcaagcgactgtggtgtttcgcgtagtactcgccaaccccctcaccagccatgac
attctcaatcaagtgctaatcgagcaaagtgaaatcgccgcactagataacgagttttta
cccgcactcatggcgatggttgcccaatag

DBGET integrated database retrieval system