KEGG   Shewanella baltica OS155: Sbal_2702Help
Entry
Sbal_2702         CDS       T00478                                 

Definition
(GenBank) anthranilate synthase, component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01130  Biosynthesis of antibiotics
sbl01230  Biosynthesis of amino acids
sbl02024  Quorum sensing
Module
sbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal_2702
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Sbal_2702
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sbal_2702
Enzymes [BR:sbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Sbal_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ABN62190
UniProt: A3D627
LinkDB All DBs
Position
3169164..3169787
Genome map
AA seq 207 aa AA seqDB search
MKLYLLDNFDSFTYNLVDQFRSLGCEVVIYRNDVAADFIAEKLLNEQEPAALVLSPGPGA
PHEAGSMMALIAKVAGKVPMLGICLGHQAMVEYYGGTVARAPFVVHGKASPTFHDGTGVF
AGLPSPLPVARYHSLVATHVPDCLQVIATTDAMPMAILHPEHRAVGFQFHPESILTTLGS
TLLIQTLAFLTQEMTFLPQDMTTGVTA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctatctactcgataactttgactcctttacctacaacttagtggatcaattt
cgcagcctaggctgtgaagtggtgatttaccgcaacgatgttgccgccgactttatcgct
gaaaaactgcttaacgaacaagaacccgcagccctagtgttatcgccaggtcctggtgcg
ccccatgaagcaggctctatgatggcgcttatcgccaaagtcgccggtaaagtgcctatg
ctgggtatctgccttgggcatcaagctatggtggaatattacggcggcacagtggcgcgc
gcgccttttgtggtgcatggcaaggcaagcccgactttccatgatggcactggcgtattt
gccggtttgccctctcccctgcccgttgcccgttatcacagtctagtcgccactcacgtg
cctgattgcttgcaagtgattgcaacgactgacgctatgccgatggcaattctgcaccct
gagcacagagccgttggctttcagttccaccctgaatcgattctcaccaccttaggtagc
acactgctcattcaaaccttggcctttcttacccaagagatgacatttctaccccaagac
atgacaacaggagtaaccgcatga

DBGET integrated database retrieval system