KEGG   Shewanella baltica OS185: Shew185_0395
Entry
Shew185_0395      CDS       T00571                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0395
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Shew185_0395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0395
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbm03036]
    Shew185_0395
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew185_0395
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Shew185_0395
Chromosome and associated proteins [BR:sbm03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Shew185_0395
SSDB
Motif
Pfam: Transpeptidase PBP_dimer RNase_J_C
Other DBs
NCBI-ProteinID: ABS06564
LinkDB
Position
441527..443281
AA seq 584 aa
MTRQAKIKRVSKPQKPQLIHWRLYVVVGFVCTLFCSLVGRAAYIQIIEPDKLRHESDMRT
LRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNGFADMRRWQALADVLHEPV
EDILDRVRSNPTKRFTYLKRQITPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGI
TNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVERLDIIQEGESPNDLVLSIDQRI
QQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSYNPNARDNLQTFRMRNRAMT
DTFEPGSTIKPFVVAAALEAGTVKSTDIIATSPGWMRLGGRQVRDPANYGDMSLARILAK
SSNVGISKLALSIPVQQLLGTYQSMGLGSFSGINLTGESAGVIQDRHRWSDFERATLSFG
YGLTATTLQLARMYATLGNGGTLFPVSIMKLKKPPIGERVISEDVAHDVMQMLVGVTEKG
GTGTLAHIDGYPVAGKSGTSRKAVAGGYGDDYVALFAGVAPANNPKLAIVVVVNEPKGDL
YYGGSVAGPAFAKVMSGALQMLNVEPITDKEQVQLAGIAAGRAE
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgactaggcaagcgaaaatcaaacgggtaagcaaaccgcagaaaccacaactaatccat
tggcgtttatacgtagtggtgggctttgtgtgtacgctattttgcagcctagtgggacgc
gcggcctacattcaaattatcgaacctgataaattacgccatgaaagcgatatgcgtact
ttacggaccacgagccgtgaggtgcagcgtggtttgatcaccgatcgcaatggcgacatg
ttggccgtcagtgtgccagtgcgtgccgtttgggccgaccctaaacaagttaacgataac
aatggctttgcggatatgcgccgctggcaagctttagctgatgtgttgcatgaacccgta
gaagacatattagatcgggtgcgcagtaatcccaccaaacgctttacctacttaaaacgc
caaattaccccagcggtcgcggactacatcactcagctgaaattacccggtgttttcctt
aaatctgaatcccgtcgctattaccctggtggtgaaatcactgctcagcttatcggtatc
actaacattgatgatgttgggattgaaggcgtagaaaatgcttataacagctggctaacg
ggcacgccttcaaaacagaaagtgcgtaaatcccgtgatggtcatgtggttgagcgcctc
gatattatccaagaaggcgaaagcccgaatgatcttgtgctcagcatagatcaacggatt
cagcagttagcgtaccgcgagctgaaacgcaccacagagatgaaccaagcgacctcaggt
tccatcgtcgtactcgatattcacactggtgaagtcttggcgatggtaaatacaccttcg
tacaaccctaatgcgcgcgacaatctgcaaaccttcagaatgcgtaaccgcgccatgacg
gataccttcgagccaggttcgaccattaagccctttgtggtggctgcggcgcttgaagcg
ggcacagtcaaatcgactgacattattgctacctcaccgggttggatgcgtttaggcggc
cgccaagtgcgcgaccctgccaactacggcgacatgagtttggcgcgtattctggctaaa
tccagtaacgtcggcatcagtaaattggccttatctattccggtgcagcagttactcggc
acctatcaatctatgggacttgggagcttctcagggatcaaccttacgggtgaaagcgcg
ggcgttattcaagaccgccaccgttggtctgactttgagcgcgccaccttgtccttcggt
tacggtttaacggcaaccacactgcaacttgcgcgcatgtatgccactttaggcaatggc
ggcaccttattccccgtttcaattatgaaactgaaaaagccccccatcggtgagcgagtt
atttctgaagatgtggcccacgatgtgatgcaaatgctggtcggcgtgacagaaaaaggc
ggcaccggcaccttggcacatatcgatggttatccggttgcgggtaagtcaggcacaagt
cgtaaggcggttgctggcggttatggtgatgattatgttgctttatttgcgggtgttgcc
ccggcgaataatcctaagttagcgatagtggtggtggtgaacgagcccaagggcgatctc
tattatggtggttcagtggcggggccggcatttgccaaagtcatgtctggcgcactgcaa
atgttaaacgttgaacccattaccgataaagaacaagtgcaattggcgggtatcgccgcc
gggagagcagaatga

KEGG   Shewanella baltica OS185: Shew185_3317
Entry
Shew185_3317      CDS       T00571                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_3317
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Shew185_3317
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_3317
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew185_3317
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Shew185_3317
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: ABS09444
LinkDB
Position
3949243..3951099
AA seq 618 aa
MSPKKRITMHDHAAEASLFKRRALFTFFCVFALLSVLVTNLYHLQVESYKDYETRSNDNR
IRVVPIAPSRGLIYDRNGVLLAENLPFYSLDLVPEKISNMSETLDELGKLIEISEDERET
FTEALKFHRRFKPLTLKNQLTEEQVAIFSVNQHKFPGISVEAGLKRNYPYGAQITHVLGY
VGKINTRDRAQLERSDLWKNYAATKDIGKQGIEKFYESLLHGKPGHLEEEVNNRGRAIRT
LKIVPPEPGQDIYLTLDLKLQQKAVELLTGLRGSIVAIDPRDGGVLAMVSSPSYDPNQFV
QGINNKDYSALLNDKSRPLINRATQGQYAPASTIKPHLALLGLDEKVITESTRVWDPGFW
QIPGVERKYRDWRRWGHGWVNVYSAITESCDTFFYELAYKVGVDHIARFMEQFGFGQNTG
IDIFEESSGNMPSKEWKRLKYNQAWYIGDTISVGIGQGYWTATPLQLANAVGIMANKGRR
FPPHLLKSIKDNTAKIDSPINELPPIELNSPRNWNIINEAMRQTANKSRFTDATYTAAMK
TGTAQVIGVAENTKYDASKIAEHFRDNALVVAYAPFEDPKIVLAVVMENAGWGGANAGPV
ARAMLDEYMLRDTWKPQP
NT seq 1857 nt   +upstreamnt  +downstreamnt
gtgtcgccaaaaaagcggataacaatgcatgatcacgccgccgaggcgtctctttttaag
cgccgagcgctattcacctttttttgcgttttcgccctattaagcgtgttagttaccaac
ctttatcatttacaggttgaatcctataaggattatgaaactcgctcgaatgataaccgt
atccgcgttgtcccaatagctcctagccgtggtctaatttacgatcgtaacggcgtacta
ttagctgaaaacttacccttctattcactcgatctagttcccgaaaaaatcagtaacatg
tcagagaccctagatgagctcggcaagttaattgagatcagtgaggatgagcgcgaaacc
tttaccgaagcgctgaaatttcatcgccgcttcaaaccactgacgctgaaaaaccagctc
accgaagagcaagtggcgattttcagtgttaaccaacataaatttccaggcatttccgta
gaagcgggcctgaagcgtaattatccctatggcgcgcaaatcacccatgtgctgggttat
gttggcaagattaacacccgagatcgcgcccagttagagcgcagcgatctgtggaaaaac
tatgcggctaccaaagacattggtaagcaaggcattgaaaaattttatgaatccctactg
catggcaaaccgggtcacttagaagaagaagtgaacaaccgcggccgcgcgattcgcacc
ttaaaaattgtgccgccagagccggggcaagatatttacctgacattagatctcaagctg
cagcaaaaagcagttgagctactcacaggtctgcgcggttctattgttgcaattgatccc
cgtgacggtggcgttttagctatggtgtcgagcccaagctacgatccaaaccaatttgtg
caagggattaataacaaagattacagcgccttactcaacgataaatcacgcccgttaatc
aaccgtgcgacccaaggccaatatgcgcccgcatcaaccatcaagccccatctcgcactc
ttaggtttagatgaaaaagtcattaccgagagcacccgtgtgtgggaccctggtttttgg
caaattcccggtgtcgaacgtaagtaccgtgactggagacgctggggacacggctgggtt
aacgtttacagtgccattaccgaatcctgcgataccttcttctacgaactcgcctacaaa
gttggggtagaccatattgcccgctttatggagcaatttggctttggtcaaaataccgga
atcgatatctttgaagaatcttctggcaacatgccatccaaagaatggaaacgcttaaag
tacaatcaagcttggtacataggcgataccatttccgtcggtattggccaaggttattgg
acagcaaccccattacaactggcgaatgccgttgggatcatggctaacaaaggccgtcgt
tttccgccgcatctgctgaagtccattaaagacaatacggccaagattgactcaccgatt
aatgagttaccgccgattgagcttaatagtccccgtaactggaatatcatcaacgaagcg
atgcgccagacggcgaataaatcacgcttcaccgatgccacttacaccgctgcgatgaaa
accggtacggcgcaggttattggcgtggcagaaaataccaaatacgatgcgagtaaaatt
gccgaacatttccgcgataacgccttagttgtggcctatgcgcccttcgaagatcctaaa
atcgtcctcgccgtcgtgatggaaaacgcgggttggggtggcgcaaatgctggccctgtc
gctcgcgccatgctcgatgaatatatgcttagagatacttggaaaccgcaaccatga

DBGET integrated database retrieval system