KEGG   Shewanella baltica OS185: Shew185_0396
Entry
Shew185_0396      CDS       T00571                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00300  Lysine biosynthesis
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Shew185_0396
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0396
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0396
Enzymes [BR:sbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Shew185_0396
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Amino acid ligase
   Shew185_0396
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: ABS06565
LinkDB
Position
443278..444777
AA seq 499 aa
MMLLRDLLAPWLHYAGAQSFNDLTLDSRAIRRGDVFLALPGHKVDGRQFIEKALDLGAAA
VLVHTDDADQHGKVLHSDNVEHGVQIYVFQLSRQVSAIAAQRYPLAHQSATTSLGVIGIT
GTNGKTSTSQLIAQLITSLGRKAAVMGTLGNGLWGELVDSGNTTTDAITLMRQLHDFEAQ
GASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYAAAKQSLFRFSTLG
HGLLNLDDAVGASWLTELKSVPAQMWGFSIEGHQAAAFYTKNAKFDDQGVSATLVWPEGE
TQIHSPLLGAFNLSNLLAALSALYLQGFDMKALAEQVQYLTPVAGRMERFTTANNITLVV
DYAHTPDAIEQALNALRRHCAGDLWCVFGCGGDRDKGKRPLMGKAAEQYADRIMVTSDNA
RSEDPAQIITDIIQGLTLSQQALTQVDRIAAIKEVVALAKPGDVILLAGKGHETYQEAAG
VRHDYDERALARQLSEQSR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgatgttattacgggatctgctcgcgccttggctgcattatgccggcgcgcagtccttc
aacgatttgaccttagatagccgcgcaatacgtcgcggcgatgtgtttttggcgctgcca
ggacataaggttgatggcagacagtttattgaaaaagccttagatttaggtgccgcagcc
gtattagtccacacggatgatgctgatcagcatggcaaagtgttgcacagcgataatgtc
gagcacggcgtacagatttatgtcttccagttgagtcgccaagtatcggccatcgccgcc
cagcgttatcccttagcgcatcagtctgcgacaacatcccttggggtgattggtattact
ggcaccaatggtaaaacctcgacaagccaactgattgcccagctgataacgtcgctcggc
cgcaaagccgctgtgatgggcacccttggcaatggtctctggggcgagcttgtcgatagc
ggcaataccacaaccgatgctattaccctaatgcgtcagttgcatgactttgaagctcaa
ggcgcgagtgtctgcgccatggaagtgtcgagccacggcttagtgcaaggccgcgtcgat
gcagtaccattcgatgttgccgtatttaccaatctgacgcgcgatcacctcgattaccac
ggcgacatggaaagctatgccgccgctaagcaaagcctatttcgtttcagcaccttaggt
cacggtttattgaatcttgacgacgcggttggtgcatcttggttgactgaacttaaatct
gtgcccgcgcaaatgtggggctttagtattgaaggtcatcaagccgcggctttttatact
aaaaatgccaagtttgacgatcaaggtgtcagtgcaaccttagtctggcccgagggcgag
actcaaatccactcaccacttcttggtgcctttaatctctctaatttactcgcggcgcta
tcggccttgtatctgcaaggttttgatatgaaagcgttagccgagcaagtgcaatactta
acgcccgtcgcaggtcgtatggagcgtttcacaactgcgaataacatcaccttagtggtc
gattatgcccatacgccagatgcgattgaacaagcgttaaacgcgctacgtcgccattgt
gctggtgatttatggtgcgtatttggctgtggtggcgaccgtgataagggcaagcgtcct
ttgatgggcaaagctgcagaacagtatgctgaccgcattatggtgacgagcgacaatgcg
cgcagtgaagaccccgcgcaaattattaccgatattatccaagggctaaccctctctcag
caggcattgactcaggttgaccgtatcgcagcaattaaagaggttgtggcattggcgaaa
cctggcgatgtgatcttgctggcgggcaaaggccacgaaacttaccaagaggcggcaggt
gtgcgtcatgactatgatgaacgcgccctggcacgccagttatcggagcaatcaagatga

DBGET integrated database retrieval system