KEGG   Shewanella baltica OS185: Shew185_0397
Entry
Shew185_0397      CDS       T00571                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanyl ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00300  Lysine biosynthesis
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
sbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Shew185_0397
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0397
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Shew185_0397
Enzymes [BR:sbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Shew185_0397
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: ABS06566
LinkDB
Position
444774..446156
AA seq 460 aa
MIPLSLETLSQHLGTFRVGDDVTIEDLSSDSRKIGAATLFVALKGERFDGHDFAATAIEN
GAAALMVERELAFDIPQLIVPDCQKAMGAIGAYVRDQINPICVALTGSNGKTSVKEMIAT
ILSAKHQILYTAGNFNNEIGVPLTLLRLTPADEFGIFELGANHKGEIDYTSGLVRPNVAL
VNNVGSAHLEGFGSQAGVAQAKSEIFNHLQADGTAIINADDAFADFMSVKARPYKQLSFS
QQDGAAKRHIDVIATGHKANADGCYRFMLNYLGESCQVVLPLAGRHQVSNALAAASVCIA
LGLSLTEIAEGLSQLTPVKGRMQPSQLGRVRLIDDSYNANPVSVGAAIAWLKEISENRCL
VLGDLGELGDNAPLLHAELGQLAKQQGIDALFCTGTLSQHTSQAFGAEHYDSVATLVEKL
IKHINQLPGQVTVLVKGSRSAAMERVVDGLTVAFGRGELV
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgatccctctttctctcgaaaccctaagtcaacacttaggtacgtttcgagtcggtgac
gacgtcaccatcgaagatttaagcagtgatagccgcaaaatcggcgctgcaaccctgttt
gttgccttaaagggtgagcgttttgatggccatgattttgctgcaaccgctattgagaac
ggcgccgcggcgttaatggtcgagcgcgaattagcctttgatattccgcagctgattgtg
cccgattgccaaaaagccatgggcgcgataggggcttatgtccgtgaccaaatcaatccg
atttgcgtggcgttaacaggctcaaacggtaagaccagcgtgaaggaaatgatcgcgacc
attctgtcggcaaagcatcaaatcctctataccgctggtaacttcaacaatgaaatcggt
gtgccgcttaccttgctgcgtttaacgccagcggatgagtttggaatattcgaactcggc
gcaaaccataaaggtgaaattgattacacctcaggactcgtgcgtccgaacgtggcgctg
gtgaataacgtcggcagcgcccatttagaaggatttggatcgcaagcaggtgttgcgcag
gctaagtcggaaatttttaatcatctgcaggccgatggcaccgccatcatcaacgccgat
gatgccttcgccgattttatgagcgttaaggcaagaccttataagcaactgagtttctcc
cagcaagatggtgctgctaaacgtcatatcgatgtcatcgctacaggtcataaggccaat
gccgatggctgctatcgttttatgctcaattatttaggtgaatcttgccaagtagtcttg
ccactggcgggccgccatcaggtgagtaatgctctcgccgctgcaagtgtttgtattgcc
ttgggattaagtttgacagagatcgccgaaggcttaagccaattaacaccagtgaaaggg
cgcatgcagccgagtcaattgggacgcgtacgtctaatcgacgatagctataacgcgaat
cctgtatccgttggggcggcaatcgcttggttaaaggaaatttctgaaaatcgctgtctg
gtactgggagatttaggagaattaggcgacaatgcgccccttttacacgctgaactaggg
caactggccaagcaacaggggatagatgccttgttttgcaccggaacgttaagtcagcac
acgagccaagctttcggtgcggagcactatgacagtgtggcgacgttagtagaaaaactc
ataaagcatattaaccagttaccgggacaggtaacggttctcgttaaaggttcacgtagc
gccgccatggagcgggtcgtggatggactaacagtagccttcgggcgtggggagttagtg
taa

DBGET integrated database retrieval system