KEGG   Shewanella baltica OS185: Shew185_0398
Entry
Shew185_0398      CDS       T00571                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
sbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0398
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Shew185_0398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0398
Enzymes [BR:sbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     Shew185_0398
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Glycosyltransferase
   Shew185_0398
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: ABS06567
UniProt: A6WIC8
LinkDB
Position
446157..447239
AA seq 360 aa
MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALVFSLWFGPKLIERLQLLQIGQVVRND
GPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYRKV
VRKDTKGLIARWKYILQSLAALLIAFFLYATAANPGETQLVVPFFKDVMPQLGAVFIVLA
YFTIVGASNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHAQFANYLHIPHLPGSGELV
IVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIMGGVFVME
TLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIFLVLLGLATLKLR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctggtatatctggccgagtatttaacccgttttcataccgggtttaacgtgttttcc
tatgtgacatttcgagccattttaggcttattgaccgcattggtttttagtttatggttt
ggccctaaactgatcgagcgtttgcaattactgcaaattggtcaggtcgtgcgtaacgac
ggtccagaatcacattttagtaagcgtggcacgccgactatggggggcttgctcatatta
gctgctatcttcatcagcgttttgctgtggggcgatctcggtagccgctatgtgtgggtg
atgttgtttgtgctcggcagtttcggtttgatcggctttatcgacgattaccgcaaagtg
gtgcgtaaagacactaaaggtttgatcgcgcgctggaagtacattctgcaatctttagct
gcgctgctcattgcttttttcctgtatgccacagcggcaaatccaggtgaaacccagtta
gtggtgcctttctttaaagacgtgatgccgcaacttggcgccgtatttatcgtattggcg
tacttcactattgtgggggcgagtaatgcggtgaacttaaccgacggcctcgacggtttg
gccattatgccgacggtaatggtcgcggcggcgtttgccttgattgcttatttgtccggt
cacgcgcagtttgcgaactacttacatattccgcatttacccggttcgggtgagcttgtg
attgtctgtaccgccattgtcggtgcgggtctgggctttttgtggttcaacacttacccc
gcgcaagtcttcatgggtgatgtgggttctctgtcattaggtgctgcactggggacaatt
gcagtgctcgttcgccaagagattttgttagtgatcatgggcggcgtgttcgtgatggaa
accctgtcagtcatcctacaggtgggttcgtacaagttacgcggccagcgtattttccgc
atggcgccgatacaccatcactatgagttaaaaggctggcctgaacctcgagtgatagtg
cgtttttggattatctcgatattcctcgtcttacttggcttagccacgttgaagttaagg
taa

DBGET integrated database retrieval system