KEGG   Shewanella baltica OS185: Shew185_0401
Entry
Shew185_0401      CDS       T00571                                 

Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
sbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0401
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Shew185_0401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0401
Enzymes [BR:sbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Shew185_0401
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Glycosyltransferase
   Shew185_0401
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_trans_4_2
Other DBs
NCBI-ProteinID: ABS06570
UniProt: A6WID1
LinkDB
Position
449766..450854
AA seq 362 aa
MTPAGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADRMEARLVPQYGFDIDFI
DIKGVRGNGLIRKLAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAARLAGIP
LVLHEQNAIPGMTNKLLSRIATQVLCAFKNTFTTVKAKVVGNPIRQELIALGAQPKPEAD
KALKVLVVGGSLGAKVFNDLMPEAVAILSQQQSVTVWHQVGKDNLAGVKAAYQQHGQDGG
VNIAEFIDDMEAAYRWADVVLCRAGALTVSELAAVGLPSILVPYPHAVDDHQTRNGQVLV
EAGAAFLLPQAILDVNKLAGKLQLLANDRTELARMGQRARDVAVLDATEQVAAVCISLAE
KG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaccccagcaggaaaacgaattttagtcatggcgggtggtacgggaggacatgtgttc
ccggcgctggcagtggctaagtatctagctcaacagggttggcaagtgcgttggttaggc
acggccgatcgtatggaggcgcgtttagtgccccagtatggatttgatattgatttcatc
gatatcaaaggtgtgcgcggcaatggtttgatacgtaaactcgcggcgccctttaaagtg
gtgcgctcaatattgcaggctaaggcagtgattgctgagtttaaacccgatgtggtactt
ggcatgggcggattcgccagtggcccaggtggtgtggcggcaagattagccggtattcca
ttggttctgcatgagcaaaatgccatcccagggatgacgaacaagttgttgtcgcggatt
gcgacgcaagtgttatgtgcctttaaaaatacctttaccacagtgaaggccaaggttgtt
ggtaatccgattcgccaagaattgattgccttaggtgcgcagccaaagcctgaggctgat
aaagccttaaaagtattagttgtcggtggcagccttggcgccaaagtctttaatgatctg
atgcctgaagcggttgcgatactgagtcagcagcagtccgtaacggtttggcatcaagtg
ggtaaagataatcttgcgggcgtgaaggcggcttatcagcaacatgggcaagatggcggc
gtgaatatcgccgagtttatcgacgacatggaagccgcctatcgctgggctgatgtagta
ttgtgccgcgccggcgcgctgacagtgtctgagttagcggcggtgggactaccgagtatt
ttggtgccttatccccatgcggtggatgatcaccaaacccgtaacggccaagtattggtt
gaggctggcgctgctttcctattgccacaggccatcttggacgtgaataaactggcgggc
aaattacaactgctcgccaatgacagaacagaattagcccgtatgggccaaagagcgaga
gacgttgccgtactggatgcgactgaacaagttgccgcagtgtgcatcagccttgccgag
aaaggataa

DBGET integrated database retrieval system