KEGG   Shewanella baltica OS185: Shew185_0423
Entry
Shew185_0423      CDS       T00571                                 

Definition
(GenBank) phosphoesterase PA-phosphatase related
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0423
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     Shew185_0423
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Diphosphatase
   Shew185_0423
SSDB
Motif
Pfam: PAP2 PAP2_3 PAP2_C
Other DBs
NCBI-ProteinID: ABS06592
LinkDB
Position
479406..479918
AA seq 170 aa
MLSYVADLDKRMFCHIVSFTQRHGLYAHAKRVSTSGDGHVYLYLSVGLMLTHAQGQALFN
LMLASFLVELPLYLLLKNSIRRTRPCHALVGFESGFEPSDRFSLPSGHTAAAFVMATSVA
QVYPAAAPIAFLWAFSIGGSRIALGVHYPLDILAGASLGSGAVLLVHPVI
NT seq 513 nt   +upstreamnt  +downstreamnt
atgttgagttacgttgcagacttagataagcgaatgttttgccatatcgtgagtttcact
caacgtcatggtttatatgcccatgcaaagcgggtgtcgacgagtggcgatgggcatgtg
tatttatatttgtcagtgggcttgatgctgactcacgctcaagggcaggccttattcaac
ttgatgttagcgagttttttggtggagttgccgctgtatttattgttgaaaaatagcatt
cgccgtacacgaccctgccatgcgcttgtgggatttgagagtggctttgagccatctgat
cgcttcagtttaccgtcgggtcatacggccgcagcttttgtaatggcaacgagtgtggcg
caagtttatcccgcagcggctcctatcgcgtttttatgggcttttagcatagggggctca
cgtattgcacttggcgtgcattaccccttagatattttggcgggagcctcattggggagc
ggagcggtattactggttcatccggtgatttaa

KEGG   Shewanella baltica OS185: Shew185_1196
Entry
Shew185_1196      CDS       T00571                                 

Definition
(GenBank) putative undecaprenol kinase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_1196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_1196
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     Shew185_1196
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Precursor biosynthesis
  Diphosphatase
   Shew185_1196
SSDB
Motif
Pfam: BacA TauE PLDc_N SPC12
Other DBs
NCBI-ProteinID: ABS07347
UniProt: A6WKK8
LinkDB
Position
1432808..1433608
AA seq 266 aa
MDTFQVIILALIQGLTEFLPISSSAHLILPAQLLGWEDQGLSFDVAVNTGSLFAVVIYFR
HELWTMFNAWIASIFRGQQSEDSKLAWWIILATLPAVFFGFLAKDFIATHLRNAEVIAVT
TVVFGLLLWWADKMSRRDLTVYQTGWRKALLIGFAQALALIPGTSRSGATMTAALMLGLS
RDAAARFSFLMSVPVSLGAAILVGKDLAKSELPIDYQALILGTLISFVAAYACIHYFLKI
ISRMGMTPFVIYRLALGAVLCGFIFF
NT seq 801 nt   +upstreamnt  +downstreamnt
atggatacgtttcaggtcattattttagcgcttattcaagggctaaccgagtttttacct
atttctagttctgcgcacttaattttacccgcacagcttttaggctgggaagatcaaggt
ttatccttcgatgtggcggtgaatacaggttcgttatttgctgtggtaatttatttcaga
cacgagttatggactatgtttaatgcttggattgcgagcattttcagaggtcaacaatcc
gaagacagcaagctggcgtggtggattattctggcgaccttgccagcggtattttttggt
tttctggcaaaggattttatcgcgactcacctacgtaacgctgaggtcatcgcggtcact
accgtcgtatttggtttattgttgtggtgggccgataagatgtcgcgccgcgatttaacg
gtttatcagacgggctggcgtaaagccttgttaattggtttcgcgcaggcattggccttg
atcccggggacttcgcgctctggtgccactatgacagcggcgctaatgttaggcttaagt
cgtgatgcagcggcccgcttttcattcttaatgtcagttcctgtgagtttaggtgcggcg
attttagtgggtaaagatctggcgaaaagtgagcttccgattgattatcaagcgttaatc
ctaggaactctgatttcgtttgttgcagcttatgcctgtattcattacttcttaaaaatc
atcagccgcatgggaatgaccccgtttgtgatctatcgtttagcactcggtgcagtcttg
tgtggatttatcttcttctag

DBGET integrated database retrieval system