KEGG   Shewanella baltica OS185: Shew185_0534Help
Entry
Shew185_0534      CDS       T00571                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
sbm  Shewanella baltica OS185
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Shew185_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ABS06702
LinkDB All DBs
Position
complement(612826..613569)
Genome map
AA seq 247 aa AA seqDB search
MFSMIDPQTLALASLIVFLGALTQSLIGFGLAVVASPLLYIVDPQLVPGPVIAMGFTISL
LTLFRERGHLEFNGLQYALLGRVPGGFIGASLLLFAPQPILGLSIAAIVAVAVILSLYKF
SLPVNKKTLFGAGVVSGIFGNIAAIGGPPMAILLSGKDASQFRAALSAFFIFSSTIAMVI
LAITGLLELKHLWLSLMLLPSVLLGYLVAGRLVGRVDKDKTKMATLVLCSISALVLTVKS
VIELLPQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttttctatgatagatccacagactcttgccttggcctcgctgattgtatttcttggc
gccttaacccagagcctgattgggtttggcctagcggttgtcgccagtcctttgctgtat
atcgtcgatccgcagctcgtaccgggtcccgttattgccatgggatttacgatctcgcta
ctgaccttattccgggaacgtggtcatttagaattcaatggcttgcaatatgcgctccta
ggtcgcgtgcccggcggttttatcggcgcgagcctgttgctgtttgcgcctcagcccata
ctcgggttatccatcgccgccattgtggctgtcgcggttatcctcagcctgtataaattc
agcctgccagtgaataagaaaaccctctttggggcgggcgtcgtctcggggattttcggt
aatattgccgctattggtggcccgccgatggcgattctattgtcaggcaaagatgcctcg
cagtttcgcgccgccctgtcggccttcttcatttttagctccaccatagctatggtcatt
ctggcgatcactggcttattagaattgaagcacctgtggctgtcgttgatgttgctgcct
tcagtgcttttagggtatttagtcgcggggcgattagtgggccgtgtcgataaagacaag
actaaaatggcgacattagtcctgtgcagtatcagcgccttagtgctaacggtgaagtcg
gttatcgagttattaccccaataa

DBGET integrated database retrieval system