KEGG   Shewanella baltica OS185: Shew185_0922
Entry
Shew185_0922      CDS       T00571                                 

Definition
(GenBank) monofunctional biosynthetic peptidoglycan transglycosylase
  KO
K03814  monofunctional glycosyltransferase [EC:2.4.1.129]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_0922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbm01003]
    Shew185_0922
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_0922
Enzymes [BR:sbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Shew185_0922
Glycosyltransferases [BR:sbm01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   Shew185_0922
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   Shew185_0922
SSDB
Motif
Pfam: Transgly
Other DBs
NCBI-ProteinID: ABS07076
LinkDB
Position
1096617..1097402
AA seq 261 aa
MTAPLYAMRDHVRRPSANKSSSPAPQRRKRGFRRLLSWLFKGLVWALICSILLVILLRFV
NPPMWTWRIERALFPPAPMGEVMHQWRDLAHISPELQLAVIAAEDQRFAEHTGFDLAAIS
SALKYNQKGTKVRGASTLSQQAAKNLFMWSSRSFFRKGLEAWFTLMMELTWDKSRILEVY
LNIVEFGPGIYGAEAASKHYFGKSAAKLTQYEASLLAAILPNPWRYKVSPPSSYVQQRSA
WIRKQMRQLGDVTLKKVHEAG
NT seq 786 nt   +upstreamnt  +downstreamnt
atgacggcccctttatatgcgatgcgagatcatgttaggcgtcctagtgccaataagtcg
agtagtcctgctcctcagaggcgtaagcgtggctttcgtcgtttattgtcttggctattc
aagggattagtatgggcattaatttgctcaatcttattggttattctactcagattcgtt
aatccacccatgtggacctggcggattgagcgcgccttatttccacccgcacctatgggg
gaagtcatgcatcagtggcgcgatttagcgcacatttctcctgagctacaattggcggtg
atcgccgcagaagatcaacgttttgccgagcatacgggattcgatttagccgcgataagt
tcggcgctgaaatacaatcagaaaggcactaaagttcgcggagccagtaccttaagtcag
caggcggcgaaaaacctgtttatgtggtctagccgcagtttctttcgtaagggattagaa
gcttggtttaccttaatgatggaactgacttgggataagtcgcgcatccttgaagtgtat
ttaaatatcgtcgaatttggcccaggtatttacggcgccgaagcggcatcaaagcattat
tttggaaagtctgcggcaaaactaacccaatatgaggcttcattactcgcagccatctta
cctaatccttggcgttataaagtgtcacctccgtcgtcctatgtgcagcagcgttccgcg
tggatccgcaaacaaatgcgccagttaggtgacgtcacgcttaaaaaagtccacgaagcg
ggatga

DBGET integrated database retrieval system