KEGG   Shewanella baltica OS185: Shew185_1449
Entry
Shew185_1449      CDS       T00571                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm00900  Terpenoid backbone biosynthesis
sbm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_1449
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shew185_1449
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sbm01006]
    Shew185_1449
Enzymes [BR:sbm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     Shew185_1449
Prenyltransferases [BR:sbm01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Shew185_1449
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ABS07599
LinkDB
Position
1748409..1749236
AA seq 275 aa
MSSTVELDPHPRTSESDLHTQTTLPGQLPELVKQSLPKHVAIIMDGNGRWAQTQGKPRVL
GHKAGVKAVRRAVSTASQLGIESLTLFAFSSENWRRPDKEVSLLMELFFTVLQREIKLLH
KNQVKLKIIGDISRFSARLQKQIAAAQEKTSGNTGLVLNVAANYGGRWDILQAAQKLAEK
VETGEMTSSQFTEEALSAHLCMQNQSEVDLMIRTGGDCRISNFVLWQAAYAELVFTDTLW
PDFDEQAFHEAIAIFASRQRRFGLTGSQIDEMRAL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgtcatccacagtggaacttgatccgcaccctaggacgagtgagagtgatttacacact
caaacgaccttgccgggacaattacccgaactcgtgaaacagtcgttacctaagcatgtt
gccattatcatggatggcaatgggcgctgggcacaaacccaaggtaaaccacgagtgttg
ggacataaggccggtgttaaggccgttagaagagccgtaagcacggcaagccaattgggc
attgaatcgctaacgttatttgcattttctagcgagaattggcgaagacccgataaagaa
gtcagcttgctgatggaattgttttttaccgtattacagcgtgaaattaaattgctgcat
aagaaccaggttaagctgaagattattggtgatatcagccggttttcggcgcgattacag
aagcaaattgcagctgcgcaagagaagacatcaggcaatactggcttggttctgaatgtt
gccgctaactatggtggccgttgggacatacttcaagcagcccaaaaattagcggaaaag
gtcgaaactggcgaaatgaccagcagtcagttcaccgaagaagccttaagtgcacatttg
tgcatgcaaaatcagagtgaagttgatttaatgatccgcacgggcggggactgtcgcatc
agcaattttgtgctgtggcaggcggcctatgcagaattggtgtttaccgacaccctttgg
cctgatttcgatgaacaggcttttcatgaagcgattgccatttttgcaagtcgccagcgc
cgctttggtttgactggaagtcagattgatgagatgcgtgcattgtaa

DBGET integrated database retrieval system