KEGG   Shewanella baltica OS185: Shew185_2271
Entry
Shew185_2271      CDS       T00571                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_2271
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbm01002]
    Shew185_2271
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_2271
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew185_2271
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Shew185_2271
Peptidases and inhibitors [BR:sbm01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Shew185_2271
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Shew185_2271
SSDB
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Other DBs
NCBI-ProteinID: ABS08409
LinkDB
Position
2706682..2708190
AA seq 502 aa
METLLKTTLYASLLLAASHTIARADQIDAGAIETRTTSLSQAVGKISPRHSQIALLAMDM
SNNQVIFSQQAETLFIPASTQKLLTAVSAMTQLGPDFRYVTELWTDAPIRKGHIAGSAYL
RFSGDPTFTQADLKAIFASLVKQGINRIDGHLYLLGDKKEQMQAPGWVWDDLGICFAAPV
SSYIINQNCVYGQFNPSTANKPSQVSLRTGSYGVKVSSDAVFDPKASREFCQLDLVRLGQ
NNYHLRGCYPGGEAIGLAIAVSDPFKFAQDNLTSLLKGEMSLAGKVKLGTSLPKKAKLIA
SHSSAPLPELLDTMLLKSDNLIADSLFKQLGKSYFNTQGSFTNGAAAMLRILTELGVDLS
NANIVDGSGLSRYNLLNAQQLAAVLALIHKDSRFSTLMTSLPQAGISGTLRYRMGYNKPP
LKKQIFAKTGSMQGVSNLAGFIRLPEHSDTLFVVLENGMSPELKHQHKPSFNAEFLKQLI
SVLQVPSPTTAALSTAAHSVQD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggaaacgttactgaaaaccactctgtatgccagcctactcttagcggcgagccacact
atcgcccgcgctgatcaaatcgacgcaggagcgatagagacccgaaccacttcgcttagc
caagcggtcggcaaaatcagccctcgtcattcgcaaattgcactgctggcaatggacatg
tctaacaatcaagtgatctttagccaacaggccgagacgctgtttattcccgccagcacg
caaaaattactcaccgctgtgagcgccatgactcagcttgggcctgattttcgttatgtc
actgaattatggacggacgcaccaatacgcaagggccatatcgccggcagcgcttatctg
cgttttagtggcgatccgacgttcactcaagccgatctcaaggccatttttgccagtctc
gtgaaacaaggcattaatcgcattgatggacatctgtatttgctcggcgataaaaaagag
caaatgcaagcccctggctgggtttgggatgacttaggcatttgttttgccgcgcctgtg
tcgagttacattatcaatcaaaactgcgtctatggtcagttcaaccccagcacggccaat
aaaccatcgcaggtgagcctgcgcacggggagttatggggtaaaagtcagcagcgatgcg
gtatttgatcccaaggcgagtcgtgaattttgccagctcgatttggtacgactaggccaa
aacaactatcatctacgtggttgttatccgggcggtgaagcgattggactggcgattgcg
gtcagcgatccgttcaaatttgcccaagataacctcacctcgctgctcaaaggcgagatg
tcactggcgggtaaagttaagctcggcactagcttgcccaaaaaggcgaaactgattgcc
agccatagctcggcgccactgcctgaactgctcgatactatgttgctcaagtcggataat
ttgattgctgatagcctgtttaaacagcttggcaaaagttatttcaacacccaaggtagc
tttaccaatggtgcggcagccatgctgcggattttaacggagttaggcgtcgatctgagt
aacgctaacattgtcgatggttcagggctgtcacgctataacttgctcaatgcacagcag
ttagcggcggtattggcactcatccataaggacagccgctttagcacgttaatgaccagt
ctgccgcaagcaggaataagcggcaccttaaggtatcgcatgggttacaacaagccgccg
ctgaaaaagcaaatttttgctaaaacaggctcgatgcaaggcgtgtctaacttagcgggg
ttcatccgtttgcctgagcacagtgacaccctgtttgtggtgcttgagaatggcatgagt
cccgagcttaaacatcagcataaaccatcgtttaatgccgagtttctcaagcaattgatt
tcagtgctgcaagtgccatcccccaccacagcagcgcttagtaccgctgctcactcggtc
caagattaa

KEGG   Shewanella baltica OS185: Shew185_3321
Entry
Shew185_3321      CDS       T00571                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_3321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbm01002]
    Shew185_3321
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_3321
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew185_3321
Peptidases and inhibitors [BR:sbm01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Shew185_3321
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Shew185_3321
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Other DBs
NCBI-ProteinID: ABS09448
LinkDB
Position
3954248..3955423
AA seq 391 aa
MMNFVKSPIKTLLLISSASLPVYAAQPIITPDAPSVAAKAFVLMDYNSGQIIAESNAYES
LNPASLTKMMTSYVIGQEIKAGNVSVDDDVTISKNAWSKNFSDSSKMFIEVGTTVKVGDL
NRGIIIQSGNDACVAMAEHIAGTEGAFVDMMNSWAKQLGMRDSYFENAHGLDAENHKSTA
YDMALLGAALIRDVPDEYHIYSEKFYTFNGIKQYNRNGLLWDNSMNVDGIKTGHTSGAGY
NLVASATKDGMRLISVVMGTQSESARKAESKKLLTYGFRFFETVTPYKAGDSFITQQIWY
GDKSTVDLGVATDTPITISRGRGKDLKANFELTKPLDAPLKKGETVGRLFFQLDGKDIAQ
FPLVTLQEVNEGSWFSKLVDYFKQMFSGWFS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgatgaattttgtaaaaagtcccattaaaacattgctgctaatttccagtgcctctctc
cccgtttatgctgcgcagcctattattacacctgatgcaccttcagtagccgccaaggcg
ttcgtattgatggattataattcgggtcagattatcgctgaaagtaacgcttacgaaagc
cttaacccagccagtttaactaagatgatgaccagttacgtgatcggtcaagaaatcaaa
gcgggcaatgtctccgttgatgatgatgtgactatcagtaaaaatgcttggtctaaaaac
ttctcagactcttctaagatgttcattgaagtgggcactacggttaaagtgggcgaccta
aaccgcggtatcattattcaatcgggtaacgatgcgtgtgtggcgatggccgagcacatt
gctggtactgaaggcgccttcgttgacatgatgaactcatgggcgaagcaattggggatg
cgtgatagctacttcgaaaacgcccacggtttagatgcagaaaaccacaaatcaaccgcc
tatgatatggcattactgggcgcagcgttaatccgcgacgtgccagatgaataccacatc
tatagcgaaaaattctatacattcaatggtatcaaacaatacaaccgtaatggtttattg
tgggataacagcatgaacgtggacggtatcaaaaccggtcacacctcaggtgcaggctac
aacttagtagcatcagcaaccaaagacggcatgcgtttaatttcagtggtgatgggcact
caaagtgaatctgcccgtaaagctgaaagtaagaaattactgacctatggcttccgtttc
ttcgaaaccgtaacaccatacaaggcgggcgatagctttatcactcagcaaatttggtac
ggtgacaagagcacggttgatttaggcgtggcaactgacacacctatcaccatcagccgt
ggccgtggtaaagacttgaaagctaacttcgagctgactaagccattagatgcaccgttg
aaaaaaggtgaaactgttggccgtctattcttccaacttgatggtaaagacatcgcccag
ttcccactggtgacgttgcaagaagtcaacgaaggcagctggtttagtaaattagtagat
tactttaaacagatgttttctggatggtttagctaa

DBGET integrated database retrieval system