KEGG   Shewanella baltica OS185: Shew185_4090Help
Entry
Shew185_4090      CDS       T00571                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00550  Peptidoglycan biosynthesis
sbm01100  Metabolic pathways
sbm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew185_4090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Shew185_4090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbm01003]
    Shew185_4090
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
    Shew185_4090
Enzymes [BR:sbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Shew185_4090
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew185_4090
Glycosyltransferases [BR:sbm01003]
 Polysaccharide
  Bacterial polysaccharide
   Shew185_4090
Peptidoglycan biosynthesis and degradation proteins [BR:sbm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Shew185_4090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ABS10207
LinkDB All DBs
Position
4870944..4873478
Genome map
AA seq 844 aa AA seqDB search
MKWLKRIVIALFSLALLGVGAIVAAYFYVLPDLPDVSTLKNVQLQTPLRIYSSDGKLISQ
FGEKRRIPLKLDEVPKPLLQAFIATEDARFYEHGGIDPVGVLRAALVMLTTGEKKQGAST
ITMQVARNFFLTRDKTIIRKVKEIFISYHIEELLTKDEILELYVNRIYLGQRAYGVGAAA
QVYFGKDVKDLTLSEMSMIAGLPKAPSTLNPVTSPSRAVARRNVVLMRMNEVGYISQAEY
QAALQEPLVAKYHGAEIDLYAPYISEMARDYMVQKYGEEEAYTNGYNVYTTISSDIQLKA
QQALRNNVYAYDERHGYRGPAAVLWTDEKPDQAQIKAELAKVASIQELQPAAVISVADQQ
ASVMTAKGETKVITWDGLKWARKFITDKRQGSVPKSASDMLKVGERIWIRDNGQYLQLSQ
VPEVASATVSLDPQNGAIRSLVGGYSFSQSQYNRVTQAKRQLGSNIKPFIYAGALEKGFT
LATLINNAPINKPDISQGTAWRPKNSPDIYGGPTRLRVGLAQSINVMSVRAMRHVGLDAT
IAELIKFGFDPNDLPRNESIALGSSSVTPLQVVTAFNVFANGGFLLEPFYIDRVEDAYGN
VIEKANPTLACKPSQSLSQPITPSDPMAFSVTGDSSTEPSAPVAQCFEQTGRFAPQIISE
QTAFLITEALKSVIWGGGDWSHGTGWQGTAWRAARLIKRHDIAGKTGTTNESRDTWFSGF
SPVLTSTFWVGFDDHGRQLGRTAWNANGEKDQITGAEAGAKTAGPGWNEFMNSVLQGTPE
TTSIPPEGIVSVRIDLATGKLTRKTDYTSAFEYFISGTEPKEYISETQDENNIFIDAPTD
DLFQ
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggttaaaacgtattgttatagcactattcagtctagcccttttgggagtaggc
gccattgtggcagcatacttttatgttttgccggatttgccggatgtttcaacactaaaa
aatgtgcaacttcaaacacctttacgcatctacagcagtgacggcaaacttatttcacaa
tttggtgagaaacgtcgcattccattgaagttagacgaagtgccaaaacccctacttcaa
gcgtttatcgcaactgaagatgcgcgtttttacgagcatggtggtatagatcctgtaggt
gtacttcgcgccgcattagtgatgttgaccacaggtgagaaaaagcaaggtgccagtacc
attaccatgcaggttgcgcgtaacttcttcttaacccgcgataaaaccattattcgtaaa
gtgaaggagatttttatctcctatcacattgaagaattactcaccaaagacgagatttta
gaactctatgtgaaccgcatttacttaggccaacgcgcctatggtgttggtgccgctgca
caagtttatttcggtaaagatgttaaagaccttacactctcagaaatgagtatgatcgcg
ggcttacccaaagcgccttcgacactcaaccctgtgacctcaccttctcgtgccgtcgct
cgccgtaatgtcgtcctcatgcggatgaatgaagtaggttacatcagccaagccgaatac
caagccgcactacaagaaccgctggtcgctaaataccacggcgccgaaattgatctctat
gcgccgtatatttctgaaatggcacgagattatatggtgcaaaagtacggagaagaagaa
gcttataccaatggctacaacgtctacacaaccatttcatcggatatacagctgaaagct
cagcaagcattacgtaataacgtttatgcctatgatgagcgtcatggctaccgtggtcct
gccgccgttctgtggacagatgaaaaaccagatcaagctcaaatcaaggctgaactggcc
aaggtggcttcaattcaagaactgcaacccgcagcagtcatcagcgtggcagatcaacaa
gccagtgtcatgaccgccaagggcgagactaaagtcattacttgggatggtttgaagtgg
gcgcgtaaatttattaccgataaacgtcaaggcagtgtacctaagtcagcttctgacatg
ctcaaggttggtgagcgtatttggatccgtgataacggccaatatttgcagttatcgcaa
gtaccagaagttgccagcgcgactgtgtcactcgacccacaaaatggtgcgattcgttct
ttagtcggcggatatagctttagccaaagccaatacaaccgcgtcactcaagcaaaacgc
caattaggttcgaacatcaaacctttcatctatgctggcgcattagagaaaggctttacc
ttagcgaccctcatcaacaatgcaccgatcaataaacccgatatcagccaaggcaccgca
tggcgccctaaaaactcgcctgatatctatggcggcccaacccgtttacgtgtgggctta
gcgcaatcaatcaacgtgatgtctgtgcgtgcaatgcgccatgtcggactcgatgccacc
attgctgaattgataaaatttggtttcgaccctaatgacctaccgcgtaacgagtcgatt
gcattaggttcgtcttcagtaacgccattacaagtggtcacggcatttaacgtgtttgct
aacggcggtttcttactcgaacctttctacatcgatcgcgtcgaagatgcctacggtaat
gtgattgaaaaagcgaatccaacattggcctgtaagcctagccaaagtcttagccaacca
attacaccgagcgatcctatggcgttcagtgtaactggagactctagtactgaaccgagt
gcacctgttgcccagtgtttcgagcaaacgggtcgctttgcaccacagatcatttcagag
caaactgcattcctcatcaccgaggcgttaaagagcgtgatctggggtggcggtgattgg
agtcacggcactggctggcaaggtacggcttggcgtgctgcaagattgattaaacgccat
gatattgcgggtaaaacaggtacaaccaacgaatctcgcgatacttggttcagtggattt
agccctgtgctcaccagtacgttctgggttggcttcgacgatcacggtcgacaactgggc
agaaccgcatggaatgccaatggtgaaaaagatcagatcaccggcgccgaagctggcgcg
aaaacggcaggtccgggttggaacgagtttatgaacagtgtcttacaaggcacacctgaa
accacatcgattccaccagaaggtattgtctcggtacgaatcgatttagcgacgggtaaa
ctcacgcgtaaaaccgactataccagtgcgttcgaatacttcatctcgggcactgagccg
aaggaatacatcagcgaaactcaggatgagaacaacatcttcatcgatgcgccaactgac
gatctattccaataa

DBGET integrated database retrieval system