KEGG   Shewanella baltica OS185: Shew185_4096Help
Entry
Shew185_4096      CDS       T00571                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00620  Pyruvate metabolism
sbm00680  Methane metabolism
sbm01100  Metabolic pathways
sbm01120  Microbial metabolism in diverse environments
sbm01200  Carbon metabolism
Module
sbm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew185_4096
  09102 Energy metabolism
   00680 Methane metabolism
    Shew185_4096
Enzymes [BR:sbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Shew185_4096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3666
Motif
Other DBs
NCBI-ProteinID: ABS10213
LinkDB All DBs
Position
4879692..4882361
Genome map
AA seq 889 aa AA seqDB search
MVVTKADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRVDQTKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QISLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLKDIVLLVGELSM
EEANDELKAYTNNSCEPYRHVLRSIRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
APLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEW
RDCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAACERGEMGLLQEMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggttgtaaccaaggcagacaatatgaccgatatgtatgcgtcattaagatcgaacgtg
agtatgttaggacaaatcctcggtgacactatgcgcacccacctcggggactcttttctc
gagaaggttgaacagatccgtaaacttgctaaagattcacgccggggcgatcaagccgct
agagagcaaatgctcgagttacttaccgccctgccagacgaagaattagttccgtttgca
aaggcatttaaccagttcctcaacttagctaatttatctgaacaatttcataccattagc
cgcaactgcgacgaactcgtctgcgtaccagatcccgtggaacagctgctaggccgcatg
ttaaatggccgtgtagaccaaacgaaaatgctcgactgccttaagacactggatatcgat
ctagtgctgacagcgcatcccactgaaatttcccgtcgcaccctgatccaaaagtacgcc
gccattgtcgactgcttaactgaacaagaaaacgatcagttatcagatagagagcgtcag
caaatcagtctgcgcctacgccaattaatcgcgcaaatctggcacaccaatgagatccgc
cgtgagcgcccaacacctgttgatgaggcccgctggggattatcgactattgaagagtca
ctctggcatgcggtgccagacttcttaagacagcttaacgaccaagtgcaacaacgcacg
ggtcaacaattaccgattgatatcgcaccagtgcgtttttcaagctggatgggcggcgat
cgcgacggcaacccctttgtgaccgcgaaagtcacccaagaggtgctcgatcgcaaccgt
catgccgccgccagattattcttaaaagacatagtcctgctggttggcgaactgtcgatg
gaagaagccaatgatgagttaaaggcttacaccaacaacagctgcgagccataccgccac
gtgttgcgatctattcgtcaaagactgcgtgacaccatagattatttaaatgcacgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatttggcaagaaagcgatctcaaa
gcgccgttagaaatgctttataagagtttgaccgactgcggtatgcgcttaatcgccaac
ggtttattgctcgatattctccgtcgcctcgcctgttttggcattcacatgctcagactc
gacattcgccaagacgccagccgtcacagcgatgtgctcgcagaattaactcgctatctc
ggcatgggtgatttcaaccattgggatgaaaccgagaaacaagctttcctattacgcgaa
ctcagcaaccgtcgtccactgatcccaagtaactggcaaccgtcagccgatgtggccgaa
gtgcttaatacctgtcgtttgatcgctaaacatccggctaaggcactcggatcctatgtg
atttcgatggcgggtaagccatcggatgtattaacggttttactgttactcaaagaaacg
ggctgttcgcacccaatgcgcgtagtgccgctatttgaaaccttaagcgacttaaacaac
gccgcagcatgtattaccgatttactcgatatcgactggtatcgtggttacaccaagggc
atgcaagaagtcatgattggctactctgactctgctaaagatgccggcgtaatggcggcg
gcttgggctcagtatcacgctcaagagcagttagtggcggtctgtaaacaagcgggcgtc
aagctcacactattccatggccgtggcggcagcattggtcgcggcggcggtcctgcacac
aaagcgattctatcccaacctccggggtcggtagatggccgtattcgtgtcactgagcag
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttagccttg
tatacctctgccgtattggaagcaaccctgttaccaccgccagagcctaaacaagaatgg
cgcgattgcatgcaacgtatcgctgaagaatcagtgggagcttatcgtggaatagtgcgt
gatgaacctgattttgtggcttatttccgtgcggcaacacccgaagtggaattaggaaag
ctgccactcggcagccgcccagctaaacgtcgtgtcgatggtgggattgaaagcctacgg
gctattccatggatttttgcttggtcacaaaaccgtttgatgttacctgcatggcttggc
gccggtgaagcgctacaagccgcctgtgaacgcggtgaaatgggcttattacaagagatg
gaacgggaatggcctttcttcagcactcgcatttcaatgctagaaatggtctacgccaag
gcggaacctaatttagcccgctactacgaaacctgtttagtaccaaaagacttgcatcac
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacaccgtggaatcgcgagtcagtaaaactgcgaaat
ccgtatatcgatccattaaacttcttacaaactgagctattagcgcggacacgtaaggaa
acaaccgaaactcccgcgtctgaacatgtgcagctagcgctaatgctgactattgcaggt
gtggcagcgggaatgagaaacactggttaa

DBGET integrated database retrieval system